![Western Blot: TARS Antibody [NBP1-89427] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: U-251 MG](http://images.novusbio.com/fullsize/TARS-Antibody-Western-Blot-NBP1-89427-img0006.jpg "Western Blot: TARS Antibody [NBP1-89427] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: U-251 MG")
| Reactivity | HuSpecies Glossary |
| Applications | WB, Simple Western, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MFEEKASSPSGKMGGEEKPIGAGEEKQKEGGKKKNKEGSGDGGRAELNPWPEYIYTRLEMYNIL |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TARS1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. In Simple Western only 10-15 uL of the recommended dilution is used per data point. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TARS1 |
![Immunocytochemistry/Immunofluorescence: TARS Antibody [NBP1-89427] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & actin filaments.](http://images.novusbio.com/fullsize/TARS-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89427-img0009.jpg "Immunocytochemistry/Immunofluorescence: TARS Antibody [NBP1-89427] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & actin filaments.")
![Immunohistochemistry-Paraffin: TARS Antibody [NBP1-89427] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.](http://images.novusbio.com/fullsize/TARS-Antibody-Immunohistochemistry-Paraffin-NBP1-89427-img0005.jpg "Immunohistochemistry-Paraffin: TARS Antibody [NBP1-89427] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.")
![Simple Western: TARS Antibody [NBP1-89427] - Simple Western lane view shows a specific band for TARS in 0.2 mg/ml of U-251 MG (left) and H. Pancreas (right) lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation systems.](http://images.novusbio.com/fullsize/TARS-Antibody-Simple-Western-NBP1-89427-img0007.jpg "Simple Western: TARS Antibody [NBP1-89427] - Simple Western lane view shows a specific band for TARS in 0.2 mg/ml of U-251 MG (left) and H. Pancreas (right) lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation systems.")
![Simple Western: TARS Antibody [NBP1-89427] - Electropherogram image of the corresponding Simple Western lane view. TARS antibody was used at 1:25 dilution on U-251 MG and H. Pancreas lysate(s) respectively.](http://images.novusbio.com/fullsize/TARS-Antibody-Simple-Western-NBP1-89427-img0008.jpg "Simple Western: TARS Antibody [NBP1-89427] - Electropherogram image of the corresponding Simple Western lane view. TARS antibody was used at 1:25 dilution on U-251 MG and H. Pancreas lysate(s) respectively.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")