Home » Snapin » Snapin Proteins » Snapin Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Snapin Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Snapin Protein (NBP1-92414PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Snapin Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SNAPIN.

Source: E. coli

Amino Acid Sequence: LDSHVHAVRESQVELREQIDNLATELCRINEDQKVALDLDPYVKKLLNARRRVVLVNNILQNAQERLRRLNHSVAKETARRRAMLDSGIYP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SNAPIN
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-92414.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Snapin Recombinant Protein Antigen

  • SNAP-25-binding protein
  • SNAP25BP
  • SNAPAP
  • SNAPAPSNARE-associated protein Snapin
  • SNAP-associated proteinSNARE associated protein snapin
  • Snapin
  • Synaptosomal-associated protein 25-binding protein

Background

SNAPIN is a component of the SNARE complex of proteins that is required for synaptic vesicle docking and fusion. It may modulate a step between vesicle priming, fusion and calcium dependent neurotransmitter release by potentiating the interaction of synaptotagmins with the SNAREs and the plasma membrane associated protein SNAP25. Its phosphorylation state influences exocytotic protein interactions and may regulate synaptic vesicle exocytosis. It may also have a role in the mechanisms of SNARE mediated membrane fusion in non neuronal cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

SNAP25 Antibody
(OTI4G5)
NBP2-00795
Flow Cytometry SNAP25 Antibody (OTI4G5)
Western Blot SNAP25 Antibody (OTI4G5)
Immunohistochemistry-Paraffin SNAP25 Antibody (OTI4G5)
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Synaptotagmin 1
Antibody (ASV48) [Unc ...
MAB4364
Immunocytochemistry Synaptotagmin 1 Antibody (ASV48) [Unconjugated]
Immunohistochemistry Synaptotagmin 1 Antibody (ASV48) [Unconjugated]
Immunocytochemistry Synaptotagmin 1 Antibody (ASV48) [Unconjugated]
(1 Publication)
Species: Rt
Applications: ICC, IHC, IP, KO, WB
Dysbindin Antibody
NBP1-85299
Immunocytochemistry/ Immunofluorescence Dysbindin Antibody
Immunohistochemistry-Paraffin Dysbindin Antibody
Immunohistochemistry-Paraffin Dysbindin Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
SNAP23 Antibody
NBP2-20434
Western Blot SNAP23 Antibody
Immunocytochemistry/ Immunofluorescence SNAP23 Antibody
Western Blot SNAP23 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
VAMP-2 Antibody
NB300-595
Flow Cytometry VAMP-2 Antibody
Western Blot VAMP-2 Antibody
Western Blot VAMP-2 Antibody
(4 Publications)
Species: Bv, Mu, Pm, Rt
Applications: Flow, IF, IHC, IHC-P, IP, WB
Collectrin/TMEM27
Antibody [Unconjugate ...
AF4965
Western Blot Collectrin/TMEM27 Antibody [Unconjugated]
Immunohistochemistry Collectrin/TMEM27 Antibody [Unconjugated]
Simple Western Collectrin/TMEM27 Antibody [Unconjugated]
(1 Publication)
Species: Mu
Applications: IHC, Simple Western, WB
Pallidin Antibody
(OTI1H9)
NBP2-01763
Western Blot Pallidin Antibody (OTI1H9)
Flow Cytometry Pallidin Antibody (OTI1H9)
Immunohistochemistry-Paraffin Pallidin Antibody (OTI1H9)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
BLOC1S1 Antibody
NBP2-83950
Western Blot BLOC1S1 Antibody
Species: Hu
Applications: WB
INT3 Antibody
NBP2-57633
Immunohistochemistry-Paraffin INT3 Antibody
Immunocytochemistry/ Immunofluorescence INT3 Antibody
Immunohistochemistry-Paraffin INT3 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Guanine deaminase
Antibody
NBP1-87454
Immunocytochemistry/ Immunofluorescence Guanine deaminase Antibody
Immunohistochemistry-Paraffin Guanine deaminase Antibody
Immunohistochemistry-Paraffin Guanine deaminase Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AIBZIP Antibody
(3E3)
H00148327-M01
Proximity Ligation Assay AIBZIP Antibody (3E3)
Immunocytochemistry/ Immunofluorescence AIBZIP Antibody (3E3)
Western Blot AIBZIP Antibody (3E3)
Species: Hu
Applications: ELISA, ICC/IF, KD, PLA, WB
Adenylate Cyclase
6 Antibody
NBP3-12233
Western Blot Adenylate Cyclase 6 Antibody
Immunohistochemistry-Paraffin Adenylate Cyclase 6 Antibody
Immunohistochemistry-Paraffin Adenylate Cyclase 6 Antibody
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
PRRT2 Antibody -
BSA Free
NBP2-82026
Western Blot PRRT2 Antibody - BSA Free
Immunohistochemistry PRRT2 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence PRRT2 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
TRPC6 Antibody -
BSA Free
NBP1-77260
Immunohistochemistry-Paraffin TRPC6 Antibody - BSA Free
Western Blot TRPC6 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence TRPC6 Antibody - BSA Free
(1 Publication)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
BLOC1S2 Antibody -
BSA Free
NBP3-05039
Western Blot BLOC1S2 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ELISA, WB

Publications for Snapin Protein (NBP1-92414PEP) (0)

There are no publications for Snapin Protein (NBP1-92414PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Snapin Protein (NBP1-92414PEP) (0)

There are no reviews for Snapin Protein (NBP1-92414PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Snapin Protein (NBP1-92414PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Snapin Products

Research Areas for Snapin Protein (NBP1-92414PEP)

Find related products by research area.

Blogs on Snapin

There are no specific blogs for Snapin, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Snapin Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol SNAPIN