Home » SHIP » SHIP Antibodies » SHIP Antibody (2F8U0)
Novus Biologicals products are now on bio-techne.com

SHIP Antibody (2F8U0)

 Submit a Review

Images

 
(
Enlarge)
Western Blot: SHIP Antibody (2F8U0) [NBP3-16226] - Western blot analysis of extracts of various cell lines, using SHIP1 Rabbit mAb (NBP3-16226) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
Western Blot: SHIP Antibody (2F8U0) [NBP3-16226] - Western blot analysis of extracts of various cell lines, using SHIP1 Rabbit mAb (NBP3-16226) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at ...read more
Immunohistochemistry: SHIP Antibody (2F8U0) [NBP3-16226] - Immunofluorescence analysis of mouse spleen using SHIP1 Rabbit mAb (NBP3-16226) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: SHIP Antibody (2F8U0) [NBP3-16226] - Immunohistochemistry of paraffin-embedded human spleen using SHIP1 Rabbit mAb (NBP3-16226) at dilution of 1:100 (40x lens).Perform microwave antigen ...read more
Immunohistochemistry: SHIP Antibody (2F8U0) [NBP3-16226] - Immunofluorescence analysis of rat spleen using SHIP1 Rabbit mAb (NBP3-16226) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunohistochemistry: SHIP Antibody (2F8U0) [NBP3-16226] - Immunofluorescence analysis of human spleen using SHIP1 Rabbit mAb (NBP3-16226) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC
Clone
2F8U0
Clonality
Monoclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

SHIP Antibody (2F8U0) Summary

Additional Information
Recombinant Monoclonal Antibody
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1084-1178 of human SHIP1 (Q92835). RSFTCSSSAEGRAAGGDKSQGKPKTPVSSQAPVPAKRPIKPSRSEINQQTPPTPTPRPPLPVKSPAVLHLQHSKGRDYRDNTELPHHGKHRPEEG
Isotype
IgG
Clonality
Monoclonal
Host
Rabbit
Gene
INPP5D
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS, 0.05% BSA, 50% glycerol, pH7.3
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for SHIP Antibody (2F8U0)

  • 145kD
  • EC 3.1.3
  • hp51CNMGC142142
  • Inositol polyphosphate-5-phosphatase of 145 kDa
  • inositol polyphosphate-5-phosphatase, 145kDa
  • INPP5D
  • MGC104855
  • SHIP
  • SHIPMGC142140

Background

SH2-containing inositol phosphatase 1 (SHIP) is a 145 kDa hemopoietic-specific phosphatase that hydrolyzes phosphatidylinositol-3,4,5-triphosphate to phosphatidylinositol-3, 4-bisphosphate. SHIP has been shown to bind directly a phosphorylated motif, immunoreceptor tyrosine-based inhibition motif (ITIM), present in the cytoplasmic domain of FcgammaRIIB1 (1). Also, results demonstrate that FcgammaRIIB use SHIP1 to inhibit pathways shared by receptor tyrosine kinases and immunoreceptors to trigger cell proliferation and cell activation, respectively (2).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

SHIP2/INPPL1
Antibody (3E6)
H00003636-M01
Western Blot SHIP2/INPPL1 Antibody (3E6)
ELISA SHIP2/INPPL1 Antibody (3E6)
(1 Review)
(10 Publications)
Species: Hu, Pm
Applications: ELISA, ICC/IF, WB
Src [p Tyr419]
Antibody [Unconjugate
AF2685
Western Blot Src [p Tyr419] Antibody [Unconjugated]
Simple Western Src [p Tyr419] Antibody [Unconjugated]
Immunohistochemistry Src [p Tyr419] Antibody [Unconjugated]
(1 Review)
(10 Publications)
Species: Hu
Applications: IHC, Simple Western, WB
AKT [p Ser473]
Antibody [Unconjugate ...
AF887
Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
(49 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
SHP-1 Antibody
(SR41-02)
NBP2-67321
Western Blot SHP-1 Antibody (SR41-02)
Flow Cytometry SHP-1 Antibody (SR41-02)
Immunocytochemistry/ Immunofluorescence SHP-1 Antibody (SR41-02)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
SHC1 Antibody
(OTI3A1)
NBP2-02434
Western Blot SHC1 Antibody (OTI3A1)
Immunohistochemistry-Paraffin SHC1 Antibody (OTI3A1)
Immunohistochemistry-Paraffin SHC1 Antibody (OTI3A1)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
PI 3-Kinase p110
gamma Antibody
NBP2-15071
Western Blot PI 3-Kinase p110 gamma Antibody
Immunohistochemistry-Paraffin PI 3-Kinase p110 gamma Antibody
Western Blot PI 3-Kinase p110 gamma Antibody
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
PI 3-Kinase p110
beta/PIK3CB Antibody ...
MAB2686
Western Blot PI 3-Kinase p110 beta/PIK3CB Antibody (269020)
(5 Publications)
Species: Hu
Applications: WB
PI 3-Kinase p110
delta Antibody (OTI1D ...
NBP2-46404
Immunohistochemistry PI 3-Kinase p110 delta Antibody (OTI1D11)
Immunohistochemistry PI 3-Kinase p110 delta Antibody (OTI1D11)
Immunohistochemistry PI 3-Kinase p110 delta Antibody (OTI1D11)
(1 Review)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
PIK3CA Antibody
NBP2-19804
Western Blot PIK3CA Antibody
Immunohistochemistry-Paraffin PIK3CA Antibody
Western Blot PIK3CA Antibody
(4 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
BCR Antibody
AF5129
Western Blot BCR Antibody
(1 Publication)
Species: Hu
Applications: WB
NOD2 Antibody
(2D9) - BSA Free
NB100-524
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Immunohistochemistry-Frozen NOD2 Antibody (2D9) - BSA Free
(1 Review)
(26 Publications)
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
CTLA-4
[Unconjugated]
7268-CT
Bioactivity CTLA-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
HLA DQ/DR/DP
Antibody (HLA-Pan/296 ...
NBP2-79843
Protein Array HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Western Blot HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
PTEN Antibody
[Unconjugated]
AF847
Western Blot PTEN Antibody [Unconjugated]
Simple Western PTEN Antibody [Unconjugated]
Knockout Validated PTEN Antibody [Unconjugated]
(14 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, KO, Simple Western, WB
SHP-2/PTPN11 [p
Tyr542] Antibody [Unc ...
AF3790
Western Blot SHP-2/PTPN11 [p Tyr542] Antibody [Unconjugated]
Simple Western SHP-2/PTPN11 [p Tyr542] Antibody [Unconjugated]
Immunocytochemistry SHP-2/PTPN11 [p Tyr542] Antibody [Unconjugated]
(1 Publication)
Species: Hu, Mu
Applications: ICC, Simple Western, WB
GRB2 Antibody
AF3846
Western Blot GRB2 Antibody
Immunohistochemistry GRB2 Antibody
(2 Publications)
Species: Hu, Mu, Rt
Applications: IHC, WB
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(631 Publications)
Species: Mu
Applications: ELISA
SHIP Antibody
(2F8U0)
NBP3-16226
SHIP Antibody (2F8U0)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC

Publications for SHIP Antibody (NBP3-16226) (0)

There are no publications for SHIP Antibody (NBP3-16226).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SHIP Antibody (NBP3-16226) (0)

There are no reviews for SHIP Antibody (NBP3-16226). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SHIP Antibody (NBP3-16226) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SHIP Products

Research Areas for SHIP Antibody (NBP3-16226)

Find related products by research area.

Blogs on SHIP.

Check out the latest blog posts on SHIP.
Getting SHIP-shape Over Tumour Suppression
PTEN antibodies have shown PTEN to be an important tumor suppressor and, in mutated form, a factor in cancer development. However, a recent study, led by Robert Rickert, shows that the SHIP gene may also be an important tumor suppressor in B-cell lymp...  Read full blog post.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SHIP Antibody (2F8U0) and receive a gift card or discount.


Bioinformatics

Gene Symbol INPP5D