![Immunohistochemistry-Paraffin: SEMA3G Antibody [NBP1-83881] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/SEMA3G-Antibody-Immunohistochemistry-Paraffin-NBP1-83881-img0007.jpg "Immunohistochemistry-Paraffin: SEMA3G Antibody [NBP1-83881] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VRWLLQRPGDEGPDQVKTDERVLHTERGLLFRRLSRFDAGTYTCTTLEHGFSQTVVRLALVVIVASQLDNLFPPEPKPEEPPARGGLASTPPKAWYKDILQLIG |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SEMA3G |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry Neuropilin-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Neuropilin1_AF566_Immunohistochemistry_21496.jpg)
![Immunohistochemistry Neuropilin-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Neuropilin1_AF566_Immunohistochemistry_21497.jpg)
![Western Blot Neuropilin-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Neuropilin1_AF566_Western_Blot_21557.jpg)
| Publication using NBP1-83881 | Applications | Species |
|---|---|---|
| Haggmark A, Neiman M, Drobin K et al. Classification of protein profiles from antibody microarrays using heat and detergent treatment. N Biotechnol 2012-06-01 [PMID: 22023822] |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SEMA3G |
![Immunohistochemistry-Paraffin: SEMA3G Antibody [NBP1-83881] - Staining of human cerebellum shows moderate positivity in neuropil.](http://images.novusbio.com/fullsize/SEMA3G-Antibody-Immunohistochemistry-Paraffin-NBP1-83881-img0005.jpg "Immunohistochemistry-Paraffin: SEMA3G Antibody [NBP1-83881] - Staining of human cerebellum shows moderate positivity in neuropil.")
![Immunohistochemistry-Paraffin: SEMA3G Antibody [NBP1-83881] - Staining of human kidney shows weak to moderate cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/SEMA3G-Antibody-Immunohistochemistry-Paraffin-NBP1-83881-img0006.jpg "Immunohistochemistry-Paraffin: SEMA3G Antibody [NBP1-83881] - Staining of human kidney shows weak to moderate cytoplasmic positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: SEMA3G Antibody [NBP1-83881] - Staining of human tonsil shows no positivity as expected.](http://images.novusbio.com/fullsize/SEMA3G-Antibody-Immunohistochemistry-Paraffin-NBP1-83881-img0008.jpg "Immunohistochemistry-Paraffin: SEMA3G Antibody [NBP1-83881] - Staining of human tonsil shows no positivity as expected.")
![Bioactivity Semaphorin 3A [Unconjugated]](https://images.novusbio.com/images2/Semaphorin_3A_1250S3_1473.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_871.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_872.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/VEGF_DVE00_ELISA_208.jpg)
![Immunohistochemistry Neuropilin-2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Neuropilin2_AF567_Immunohistochemistry_16084.jpg)
![Western Blot Neuropilin-2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Neuropilin2_AF567_Western_Blot_20048.jpg)
![Simple Western Neuropilin-2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Neuropilin2_AF567_Simple_Western_20049.jpg)
![Immunohistochemistry Semaphorin 3E Antibody [Unconjugated]](https://images.novusbio.com/images2/Semaphorin_3E_AF3239_Immunohistochemistry_11300.jpg)
![Flow Cytometry Semaphorin 4D/CD100 Antibody [Unconjugated]](https://images.novusbio.com/images2/Semaphorin_4D_AF5235_Flow_Cytometry_8267.jpg)
![Immunohistochemistry Semaphorin 4D/CD100 Antibody [Unconjugated]](https://images.novusbio.com/images2/Semaphorin_4D_AF5235_Immunohistochemistry_24184.jpg)
![Immunohistochemistry Plexin D1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Plexin_D1_AF4160_Immunohistochemistry_11521.jpg)
![Flow Cytometry Plexin D1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Plexin_D1_AF4160_Flow_Cytometry_8234.jpg)
![Neutralization Plexin D1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Plexin_D1_AF4160_Block_Neutralize_14419.jpg)
![Immunocytochemistry Semaphorin 3C Antibody (238835) [Unconjugated]](https://images.novusbio.com/images2/Semaphorin_3C_MAB1728_Immunocytochemistry_11554.jpg)
![Immunohistochemistry Semaphorin 3C Antibody (238835) [Unconjugated]](https://images.novusbio.com/images2/Semaphorin_3C_MAB1728_Immunohistochemistry_19277.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")