![Immunohistochemistry-Paraffin: RFX4 Antibody [NBP2-48967] - Analysis in human testis and endometrium tissues. Corresponding RFX4 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/RFX4-Antibody-Immunohistochemistry-Paraffin-NBP2-48967-img0005.jpg "Immunohistochemistry-Paraffin: RFX4 Antibody [NBP2-48967] - Analysis in human testis and endometrium tissues. Corresponding RFX4 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: STTGAMQSYTWSLTYTVTTAAGSPAENSQQLPCMRNTHVPSSSVTHRIPVYPHREEHGYTGSYNYGSYGNQHPHPMQSQYPALPH |
| Predicted Species | Mouse (93%), Rat (95%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | RFX4 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP2-48967 | Applications | Species |
|---|---|---|
| Luo G, Yogeshwar S, Lin L Et al. T cell reactivity to regulatory factor X4 in type 1 narcolepsy Sci Rep 2021-04-10 [PMID: 33837283] Details: Citation using the HRP version of this antibody. |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | RFX4 |
![Immunocytochemistry/Immunofluorescence: RFX4 Antibody [NBP2-48967] - Staining of human cell line AF22 shows localization to nucleus. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/RFX4-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-48967-img0002.jpg "Immunocytochemistry/Immunofluorescence: RFX4 Antibody [NBP2-48967] - Staining of human cell line AF22 shows localization to nucleus. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: RFX4 Antibody [NBP2-48967] - Staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/RFX4-Antibody-Immunohistochemistry-Paraffin-NBP2-48967-img0009.jpg "Immunohistochemistry-Paraffin: RFX4 Antibody [NBP2-48967] - Staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.")
![Immunohistochemistry-Paraffin: RFX4 Antibody [NBP2-48967] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuropil.](http://images.novusbio.com/fullsize/RFX4-Antibody-Immunohistochemistry-Paraffin-NBP2-48967-img0006.jpg "Immunohistochemistry-Paraffin: RFX4 Antibody [NBP2-48967] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuropil.")
![Immunohistochemistry-Paraffin: RFX4 Antibody [NBP2-48967] - Staining of human endometrium shows no positivity in glandular cells as expected.](http://images.novusbio.com/fullsize/RFX4-Antibody-Immunohistochemistry-Paraffin-NBP2-48967-img0007.jpg "Immunohistochemistry-Paraffin: RFX4 Antibody [NBP2-48967] - Staining of human endometrium shows no positivity in glandular cells as expected.")
![Immunohistochemistry-Paraffin: RFX4 Antibody [NBP2-48967] - Staining of human kidney shows no positivity in cells in tubules as expected.](http://images.novusbio.com/fullsize/RFX4-Antibody-Immunohistochemistry-Paraffin-NBP2-48967-img0008.jpg "Immunohistochemistry-Paraffin: RFX4 Antibody [NBP2-48967] - Staining of human kidney shows no positivity in cells in tubules as expected.")
![Neutralization CX3CL1/Fractalkine Antibody [Unconjugated]](https://images.novusbio.com/images2/CX3CL1_AF365_Block_Neutralize_8860.jpg)
![Western Blot Bone marrow stromal cell antigen 1/CD157 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD157_AF4736_Western_Blot_9316.jpg)
![Bioactivity Sonic Hedgehog/Shh [Unconjugated]](https://images.novusbio.com/images2/Sonic_Hedgehog_464SH_2840.jpg)
![SDS-PAGE Sonic Hedgehog/Shh [Unconjugated]](https://images.novusbio.com/images2/Sonic_Hedgehog_464-SH_341.jpg)
![SEC-MALS Sonic Hedgehog/Shh [Unconjugated]](https://images.novusbio.com/images/464-sh_recombinant-mouse-sonic-hedgehog-shh-c25ii-n-terminus-sec-mals-642023224324.jpg)
![Bioactivity CTLA-4 [Unconjugated]](https://images.novusbio.com/images2/CTLA4_7268CT_2293.jpg)
![N/A Chitinase 3-like 1/YKL-40 [HRP]](https://images.novusbio.com/images2/Chitinase_3-like_1_DC3L10_ELISA_45.jpg)
![N/A Chitinase 3-like 1/YKL-40 [HRP]](https://images.novusbio.com/images2/DATA_Chitinase_3like_1_DC3L10_ELISA_601.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")