![Western Blot: QKI/Quaking Antibody [NBP1-87178] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize/QKI-Quaking-Antibody-Western-Blot-NBP1-87178-img0017.jpg "Western Blot: QKI/Quaking Antibody [NBP1-87178] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RAEIKLKRAVEEVKKLLVPAAEGEDSLKKMQLMELAILNGTYRDANIKSPALAFSLAATAQAAPRIITGPAPVLPPAALRTPTPAGPTIMPLIRQIQTAVMPNGTPHPTAAIVPPGPEAGLIYTPYEYPYTLAPATSILEYPIEPSGVL |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | QKI |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot MAP1B [p Thr1265] Antibody - SuperBUGS](https://images.novusbio.com/images/MAP1B-[p-Thr1265]-Antibody-SuperBUGS-Western-Blot-NBP1-42827-img0005.jpg)
![Western Blot MAP1B [p Thr1265] Antibody - SuperBUGS](https://images.novusbio.com/images/MAP1B-[p-Thr1265]-Antibody---SuperBUGS-Western-Blot-NBP1-42827-img0003.jpg)
![Immunohistochemistry MAP1B [p Thr1265] Antibody - SuperBUGS](https://images.novusbio.com/images/MAP1B-[p-Thr1265]-Antibody---SuperBUGS-Immunohistochemistry-NBP1-42827-img0004.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for QKI/Quaking Antibody (NBP1-87178)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | QKI |
![Immunocytochemistry/Immunofluorescence: QKI/Quaking Antibody [NBP1-87178] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/QKI-Quaking-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87178-img0026.jpg "Immunocytochemistry/Immunofluorescence: QKI/Quaking Antibody [NBP1-87178] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: QKI/Quaking Antibody [NBP1-87178] - Staining in human cerebral cortex and pancreas tissues . Corresponding QKI RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/QKI-Quaking-Antibody-Immunohistochemistry-Paraffin-NBP1-87178-img0025.jpg "Immunohistochemistry-Paraffin: QKI/Quaking Antibody [NBP1-87178] - Staining in human cerebral cortex and pancreas tissues . Corresponding QKI RNA-seq data are presented for the same tissues.")
![Western Blot: QKI/Quaking Antibody [NBP1-87178] - Analysis in human cerebral cortex tissue.](http://images.novusbio.com/fullsize/QKI-Quaking-Antibody-Western-Blot-NBP1-87178-img0016.jpg "Western Blot: QKI/Quaking Antibody [NBP1-87178] - Analysis in human cerebral cortex tissue.")
![Immunohistochemistry: QKI/Quaking Antibody [NBP1-87178] - Staining of mouse brain shows strong positivity in a subset of glial cells in the cerebral cortex.](http://images.novusbio.com/fullsize/QKI-Quaking-Antibody-Immunohistochemistry-Paraffin-NBP1-87178-img0021.jpg "Immunohistochemistry: QKI/Quaking Antibody [NBP1-87178] - Staining of mouse brain shows strong positivity in a subset of glial cells in the cerebral cortex.")
![Immunohistochemistry-Paraffin: QKI/Quaking Antibody [NBP1-87178] - Staining of human cerebellum shows moderate to strong nuclear positivity in glial cells.](http://images.novusbio.com/fullsize/QKI-Quaking-Antibody-Immunohistochemistry-Paraffin-NBP1-87178-img0022.jpg "Immunohistochemistry-Paraffin: QKI/Quaking Antibody [NBP1-87178] - Staining of human cerebellum shows moderate to strong nuclear positivity in glial cells.")
![Immunohistochemistry-Paraffin: QKI/Quaking Antibody [NBP1-87178] - Staining of human cerebral cortex shows moderate to strong nuclear positivity in glial cells.](http://images.novusbio.com/fullsize/QKI-Quaking-Antibody-Immunohistochemistry-Paraffin-NBP1-87178-img0023.jpg "Immunohistochemistry-Paraffin: QKI/Quaking Antibody [NBP1-87178] - Staining of human cerebral cortex shows moderate to strong nuclear positivity in glial cells.")
![Immunohistochemistry-Paraffin: QKI/Quaking Antibody [NBP1-87178] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.](http://images.novusbio.com/fullsize/QKI-Quaking-Antibody-Immunohistochemistry-Paraffin-NBP1-87178-img0024.jpg "Immunohistochemistry-Paraffin: QKI/Quaking Antibody [NBP1-87178] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.")
![Western Blot p27/Kip1 [p Thr157] Antibody](https://images.novusbio.com/images2/p27_AF1555_Western_Blot_5119.jpg)
![Western Blot Cathepsin C/DPPI Antibody [Unconjugated]](https://images.novusbio.com/images2/Cathepsin_C_AF1034_Western_Blot_21534.jpg)
![Immunohistochemistry Cathepsin C/DPPI Antibody [Unconjugated]](https://images.novusbio.com/images2/Cathepsin_C_AF1034_Immunohistochemistry_11463.jpg)
![Western Blot Cathepsin C/DPPI Antibody [Unconjugated]](https://images.novusbio.com/images2/Cathepsin_C_AF1034_Western_Blot_16948.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")