![Western Blot: QKI/Quaking Antibody (1D1N6) [NBP3-15255] - Western blot analysis of extracts of various cell lines, using QKI/Quaking antibody (NBP3-15255) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.](http://images.novusbio.com/fullsize/QKI-Quaking-Antibody-1D1N6-Western-Blot-NBP3-15255-img0002.jpg "Western Blot: QKI/Quaking Antibody (1D1N6) [NBP3-15255] - Western blot analysis of extracts of various cell lines, using QKI/Quaking antibody (NBP3-15255) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC, IP |
| Clone | 1D1N6 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Additional Information | Recombinant Monoclonal Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 242-341 of human QKI/Quaking (Q96PU8). RTPTPAGPTIMPLIRQIQTAVMPNGTPHPTAAIVPPGPEAGLIYTPYEYPYTLAPATSILEYPIEPSGVLGAVATKVRRHDMRVHPYQRIVTADRAATGN |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | QKI |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Western Blot MAP1B [p Thr1265] Antibody - SuperBUGS](https://images.novusbio.com/images/MAP1B-[p-Thr1265]-Antibody-SuperBUGS-Western-Blot-NBP1-42827-img0005.jpg)
![Western Blot MAP1B [p Thr1265] Antibody - SuperBUGS](https://images.novusbio.com/images/MAP1B-[p-Thr1265]-Antibody---SuperBUGS-Western-Blot-NBP1-42827-img0003.jpg)
![Immunohistochemistry MAP1B [p Thr1265] Antibody - SuperBUGS](https://images.novusbio.com/images/MAP1B-[p-Thr1265]-Antibody---SuperBUGS-Immunohistochemistry-NBP1-42827-img0004.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for QKI/Quaking Antibody (NBP3-15255)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | QKI |
![Immunocytochemistry/Immunofluorescence: QKI/Quaking Antibody (1D1N6) [NBP3-15255] - Immunofluorescence analysis of NIH/3T3 cells using QKI/Quaking Rabbit mAb (NBP3-15255) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/QKI-Quaking-Antibody-1D1N6-Immunocytochemistry-Immunofluorescence-NBP3-15255-img0001.jpg "Immunocytochemistry/Immunofluorescence: QKI/Quaking Antibody (1D1N6) [NBP3-15255] - Immunofluorescence analysis of NIH/3T3 cells using QKI/Quaking Rabbit mAb (NBP3-15255) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![Immunoprecipitation: QKI/Quaking Antibody (1D1N6) [NBP3-15255] - Immunoprecipitation analysis of 300ug extracts of NIH/3T3 cells using 3ug QKI/Quaking antibody (NBP3-15255). Western blot was performed from the immunoprecipitate using QKI/Quaking antibody (NBP3-15255) at a dilition of 1:1000.](http://images.novusbio.com/fullsize/QKI-Quaking-Antibody-1D1N6-Immunoprecipitation-NBP3-15255-img0003.jpg "Immunoprecipitation: QKI/Quaking Antibody (1D1N6) [NBP3-15255] - Immunoprecipitation analysis of 300ug extracts of NIH/3T3 cells using 3ug QKI/Quaking antibody (NBP3-15255). Western blot was performed from the immunoprecipitate using QKI/Quaking antibody (NBP3-15255) at a dilition of 1:1000.")
![Western Blot p27/Kip1 [p Thr157] Antibody](https://images.novusbio.com/images2/p27_AF1555_Western_Blot_5119.jpg)
![Western Blot Cathepsin C/DPPI Antibody [Unconjugated]](https://images.novusbio.com/images2/Cathepsin_C_AF1034_Western_Blot_21534.jpg)
![Immunohistochemistry Cathepsin C/DPPI Antibody [Unconjugated]](https://images.novusbio.com/images2/Cathepsin_C_AF1034_Immunohistochemistry_11463.jpg)
![Western Blot Cathepsin C/DPPI Antibody [Unconjugated]](https://images.novusbio.com/images2/Cathepsin_C_AF1034_Western_Blot_16948.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")