![Western Blot: PTK9 Antibody [NBP1-90297] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize/PTK9-Antibody-Western-Blot-NBP1-90297-img0011.jpg "Western Blot: PTK9 Antibody [NBP1-90297] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, Simple Western, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: AEEELRQIKINEVQTDVGVDTKHQTLQGVAFPISREAFQALEKLNNRQLNYVQLEIDIKNEIIILANTTNTELKDLPKRIPKDSARYHFFLYKHSHEGDY |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TWF1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100. In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot RFC1 Antibody [Unconjugated]](https://images.novusbio.com/images2/RFC1_AF6457_Western_Blot_9874.jpg)
![Immunohistochemistry Neurophysin II/Arg-vasopressin Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af009_human-neurophysin-ii-affinity-purified-polyclonal-ab-immunohistochemistry-2812202013195.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for PTK9 Antibody (NBP1-90297)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TWF1 |
![Immunocytochemistry/Immunofluorescence: PTK9 Antibody [NBP1-90297] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.](http://images.novusbio.com/fullsize/PTK9-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-90297-img0012.jpg "Immunocytochemistry/Immunofluorescence: PTK9 Antibody [NBP1-90297] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.")
![Immunohistochemistry-Paraffin: PTK9 Antibody [NBP1-90297] - Staining of human urinary bladder shows moderate cytoplasmic positivity in urothelial cells.](http://images.novusbio.com/fullsize/PTK9-Antibody-Immunohistochemistry-Paraffin-NBP1-90297-img0016.jpg "Immunohistochemistry-Paraffin: PTK9 Antibody [NBP1-90297] - Staining of human urinary bladder shows moderate cytoplasmic positivity in urothelial cells.")
![Western Blot: PTK9 Antibody [NBP1-90297] - Analysis in human cell line A-431.](http://images.novusbio.com/fullsize/PTK9-Antibody-Western-Blot-NBP1-90297-img0010.jpg "Western Blot: PTK9 Antibody [NBP1-90297] - Analysis in human cell line A-431.")
![Immunohistochemistry-Paraffin: PTK9 Antibody [NBP1-90297] - Staining of human colon shows moderate cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/PTK9-Antibody-Immunohistochemistry-Paraffin-NBP1-90297-img0013.jpg "Immunohistochemistry-Paraffin: PTK9 Antibody [NBP1-90297] - Staining of human colon shows moderate cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: PTK9 Antibody [NBP1-90297] - Staining of human prostate shows moderate cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/PTK9-Antibody-Immunohistochemistry-Paraffin-NBP1-90297-img0014.jpg "Immunohistochemistry-Paraffin: PTK9 Antibody [NBP1-90297] - Staining of human prostate shows moderate cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: PTK9 Antibody [NBP1-90297] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/PTK9-Antibody-Immunohistochemistry-Paraffin-NBP1-90297-img0015.jpg "Immunohistochemistry-Paraffin: PTK9 Antibody [NBP1-90297] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
![Simple Western: PTK9 Antibody [NBP1-90297] - Simple Western lane view shows a specific band for PTK9 in 0.2 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.](http://images.novusbio.com/fullsize/PTK9-Antibody-Simple-Western-NBP1-90297-img0007.jpg "Simple Western: PTK9 Antibody [NBP1-90297] - Simple Western lane view shows a specific band for PTK9 in 0.2 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.")
![Simple Western: PTK9 Antibody [NBP1-90297] - Electropherogram image(s) of corresponding Simple Western lane view. PTK9 antibody was used at 1:40 dilution on RT-4 and U-251MG lysate(s).](http://images.novusbio.com/fullsize/PTK9-Antibody-Simple-Western-NBP1-90297-img0008.jpg "Simple Western: PTK9 Antibody [NBP1-90297] - Electropherogram image(s) of corresponding Simple Western lane view. PTK9 antibody was used at 1:40 dilution on RT-4 and U-251MG lysate(s).")
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")