![Immunohistochemistry-Paraffin: PACRG Antibody [NBP2-55838] - Staining of human placenta shows low expression as expected.](http://images.novusbio.com/fullsize/PACRG-Antibody-Immunohistochemistry-Paraffin-NBP2-55838-img0003.jpg "Immunohistochemistry-Paraffin: PACRG Antibody [NBP2-55838] - Staining of human placenta shows low expression as expected.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: AFKERPTKPTAFRKFYERGDFPIALEHDSKGNKIAWKVEIEKLDYHHYLPLF |
| Predicted Species | Mouse (94%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PACRG |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for PACRG Antibody (NBP2-55838)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PACRG |
![Immunohistochemistry-Paraffin: PACRG Antibody [NBP2-55838] - Staining of human fallopian tube shows high expression.](http://images.novusbio.com/fullsize/PACRG-Antibody-Immunohistochemistry-Paraffin-NBP2-55838-img0002.jpg "Immunohistochemistry-Paraffin: PACRG Antibody [NBP2-55838] - Staining of human fallopian tube shows high expression.")
![Immunohistochemistry-Paraffin: PACRG Antibody [NBP2-55838] - Staining in human fallopian tube and placenta tissues using anti-PACRG antibody. Corresponding PACRG RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/PACRG-Antibody-Immunohistochemistry-Paraffin-NBP2-55838-img0004.jpg "Immunohistochemistry-Paraffin: PACRG Antibody [NBP2-55838] - Staining in human fallopian tube and placenta tissues using anti-PACRG antibody. Corresponding PACRG RNA-seq data are presented for the same tissues.")
![Western Blot Parkin Antibody [Unconjugated]](https://images.novusbio.com/images2/Parkin_AF1438_Western_Blot_22174.jpg)
![Immunohistochemistry Parkin Antibody [Unconjugated]](https://images.novusbio.com/images2/Parkin_AF1438_Immunohistochemistry_6700.jpg)
![SDS-PAGE Lymphotoxin-alpha/TNF-beta [Unconjugated]](https://images.novusbio.com/images2/Lymphotoxin-alpha_211-TBB_CF_695.jpg)
![Bioactivity Lymphotoxin-alpha/TNF-beta [Unconjugated]](https://images.novusbio.com/images2/Lymphotoxin-alpha_211-TBB_CF_697.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Immunocytochemistry 5T4 Antibody [Unconjugated]](https://images.novusbio.com/images2/5T4_AF5049_Flow_Cytometry_17448.jpg)
![Flow Cytometry 5T4 Antibody [Unconjugated]](https://images.novusbio.com/images2/5T4_AF5049_Flow_Cytometry_15036.jpg)
![Bioactivity Sonic Hedgehog/Shh [Unconjugated]](https://images.novusbio.com/images2/Sonic_Hedgehog_464SH_2840.jpg)
![SDS-PAGE Sonic Hedgehog/Shh [Unconjugated]](https://images.novusbio.com/images2/Sonic_Hedgehog_464-SH_341.jpg)
![SEC-MALS Sonic Hedgehog/Shh [Unconjugated]](https://images.novusbio.com/images/464-sh_recombinant-mouse-sonic-hedgehog-shh-c25ii-n-terminus-sec-mals-642023224324.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")