![Western Blot: OXSR1 Antibody [NBP1-82929] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp](http://images.novusbio.com/fullsize/OXSR1-Antibody-Western-Blot-NBP1-82929-img0006.jpg "Western Blot: OXSR1 Antibody [NBP1-82929] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FDEESEEGKAAISQLRSPRVKESISNSELFPTTDPVGTLLQVPEQISAHLPQPAGQIATQPTQVSLPPTAEPAKTAQALSSGSGSQETKIPISLVLRLRNSKKELNDIRFE |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | OXSR1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-82929 | Applications | Species |
|---|---|---|
| Stadler C, Hjelmare M, Neumann B et al. Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy. J Proteomics 2012-04-03 [PMID: 22361696] |
Secondary Antibodies |
Isotype Controls |
Research Areas for OXSR1 Antibody (NBP1-82929)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | OXSR1 |
![Immunocytochemistry/Immunofluorescence: OXSR1 Antibody [NBP1-82929] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.](http://images.novusbio.com/fullsize/OXSR1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82929-img0008.jpg "Immunocytochemistry/Immunofluorescence: OXSR1 Antibody [NBP1-82929] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.")
![Immunohistochemistry-Paraffin: OXSR1 Antibody [NBP1-82929] - Staining in human parathyroid gland and pancreas tissues using anti-OXSR1 antibody. Corresponding OXSR1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/OXSR1-Antibody-Immunohistochemistry-Paraffin-NBP1-82929-img0011.jpg "Immunohistochemistry-Paraffin: OXSR1 Antibody [NBP1-82929] - Staining in human parathyroid gland and pancreas tissues using anti-OXSR1 antibody. Corresponding OXSR1 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: OXSR1 Antibody [NBP1-82929] - Staining of human esophagus shows strong cytoplasmic positivity in squamous epithelial cells.](http://images.novusbio.com/fullsize/OXSR1-Antibody-Immunohistochemistry-Paraffin-NBP1-82929-img0007.jpg "Immunohistochemistry-Paraffin: OXSR1 Antibody [NBP1-82929] - Staining of human esophagus shows strong cytoplasmic positivity in squamous epithelial cells.")
![Immunohistochemistry-Paraffin: OXSR1 Antibody [NBP1-82929] - Staining of human pancreas shows low expression as expected.](http://images.novusbio.com/fullsize/OXSR1-Antibody-Immunohistochemistry-Paraffin-NBP1-82929-img0009.jpg "Immunohistochemistry-Paraffin: OXSR1 Antibody [NBP1-82929] - Staining of human pancreas shows low expression as expected.")
![Immunohistochemistry-Paraffin: OXSR1 Antibody [NBP1-82929] - Staining of human parathyroid gland shows high expression.](http://images.novusbio.com/fullsize/OXSR1-Antibody-Immunohistochemistry-Paraffin-NBP1-82929-img0010.jpg "Immunohistochemistry-Paraffin: OXSR1 Antibody [NBP1-82929] - Staining of human parathyroid gland shows high expression.")
![Western Blot WNK1 Antibody [Unconjugated]](https://images.novusbio.com/images2/WNK1_AF2849_Western_Blot_5218.jpg)
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![Immunohistochemistry CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images2/CFTR_MAB25031_Immunohistochemistry_6973.jpg)
![Immunohistochemistry CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images2/CFTR_MAB25031_Immunohistochemistry_9671.jpg)
![Immunoprecipitation CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images/mab25031_human-cftr-c-terminus-mab-clone-24-1-41202412513815.jpg)
![Immunocytochemistry Pax2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Pax2_AF3364_Immunocytochemistry_14405.jpg)
![Western Blot Pax2 Antibody [Unconjugated]](https://images.novusbio.com/images2/af3364_human-pax2-affinity-purified-polyclonal-ab-western-blot-145202183852.jpg)
![Immunohistochemistry Pax2 Antibody [Unconjugated]](https://images.novusbio.com/images2/af3364_human-pax2-affinity-purified-polyclonal-ab-immunohistochemistry-192021142455.jpg)
![Simple Western p38 alpha Antibody [Unconjugated]](https://images.novusbio.com/images2/16324.jpg)
![Western Blot p38 alpha Antibody [Unconjugated]](https://images.novusbio.com/images2/p38_alpha_AF8691_Western_Blot_22371.jpg)
![Immunohistochemistry p38 alpha Antibody [Unconjugated]](https://images.novusbio.com/images2/p38_alpha_AF8691_Immunohistochemistry_7087.jpg)
![Western Blot RELT/TNFRSF19L Antibody [Unconjugated]](https://images.novusbio.com/images2/RELT_AF1385_Western_Blot_21504.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")