Home » IKK alpha » IKK alpha Proteins » IKK alpha Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

IKK alpha Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for IKK alpha Protein (NBP1-89634PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

IKK alpha Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CHUK.

Source: E. coli

Amino Acid Sequence: HTVQSQDRVLKELFGHLSKLLGCKQKIIDLLPKVEVALSNIKEADNTVMFMQGKRQKEIWHLLKIACTQSSARSLVGSSLEGAVTPQTSAWLPPTSAEHDHSLSCVVTPQDGETSAQMIEENLNCLGHLSTIIHEANEEQGNSMMN

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CHUK
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89634.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.
Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for IKK alpha Recombinant Protein Antigen

  • CHUK
  • conserved helix-loop-helix ubiquitous kinaseIKBKA
  • EC 2.7.11
  • EC 2.7.11.10
  • I-kappa-B kinase 1
  • I-kappa-B kinase alpha
  • IkappaB kinase
  • IkBKA
  • IkBKalpha
  • IKK alpha
  • IKK1
  • IKK1I-kappa-B kinase-alpha
  • IKK-A
  • IKKAIkB kinase alpha subunit
  • IKK-alphainhibitor of nuclear factor kappa-B kinase subunit alpha
  • NFKBIKA
  • NFKBIKAIKK-a kinase
  • Nuclear factor NFkappaB inhibitor kinase alpha
  • Nuclear factor NF-kappa-B inhibitor kinase alpha
  • TCF16
  • TCF-16
  • Transcription factor 16

Background

IKK-alpha (I-Kappa-B kinase-alpha) is a member of the IKK complex which is composed of IKK-alpha, IKK-beta, IKK-gamma and IKAP (1-2). Phosphorylation of I-Kappa-B on a serine residue by the IKK complex frees NF-kB from I-Kappa-B and marks it for degradation via ubiquination. Activation of NFKB by TNF requires phosphorylation of IKK-alpha at threonine 23 and serine 176 by AKT1 and NIK respectively (3). It has been demonstrated that IKK-alpha can accumulate in the nucleus after cytokine exposure (4). In the nucleus IKK-alpha interacts with CREB-binding protein in conjunction with RELA to be recruited to the NF-kappa-B-responsive promoters in order to mediate the cytokine-induced phosphorylation and subsequent acetylation of specific residues in histone H3 (5).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

IKK beta Antibody
(10AG2) - BSA Free
NB100-56509
Flow Cytometry IKK beta Antibody (10AG2) - BSA Free
Immunocytochemistry/ Immunofluorescence IKK beta Antibody (10AG2) - BSA Free
Flow Cytometry IKK beta Antibody (10AG2) - BSA Free
(2 Reviews)
(60 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, IB, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
IKK epsilon/IKBKE
Antibody (346909) [Un ...
MAB3199
Immunocytochemistry IKK epsilon/IKBKE Antibody (346909) [Unconjugated]
Western Blot IKK epsilon/IKBKE Antibody (346909) [Unconjugated]
Immunocytochemistry IKK epsilon/IKBKE Antibody (346909) [Unconjugated]
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC, WB
NFkB p105/p50
Antibody (2J10D7) - B ...
NB100-56583
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
(1 Review)
(5 Publications)
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(808 Publications)
Species: Hu
Applications: BA
IkB-alpha Antibody
(6A920) - BSA Free
NB100-56507
Knockout Validated IkB-alpha Antibody (6A920) - BSA Free
Flow Cytometry IkB-alpha Antibody (6A920) - BSA Free
Flow Cytometry IkB-alpha Antibody (6A920) - BSA Free
(42 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, KO, Simple Western, WB
Human, Mouse, Rat
RelA/NFkB p65 ELISA K ...
NBP2-29661
ELISA Human, Mouse, Rat RelA/NFkB p65 ELISA Kit (Colorimetric)
ELISA Human, Mouse, Rat RelA/NFkB p65 ELISA Kit (Colorimetric)
ELISA Human, Mouse, Rat RelA/NFkB p65 ELISA Kit (Colorimetric)
(95 Publications)
Species: Hu, Mu, Rt
Applications: ELISA
IKK gamma
Inhibitor Peptide Set
NBP2-26504
In vivo assay IKK gamma Inhibitor Peptide Set
In vivo assay IKK gamma Inhibitor Peptide Set
Unknown IKK gamma Inhibitor Peptide Set
(22 Publications)
Species: Hu, Mu, Rt
Applications: B/N, Func-Inh, In vitro, In vivo
Synaptotagmin 1
Antibody (ASV48) [Unc ...
MAB4364
Immunocytochemistry Synaptotagmin 1 Antibody (ASV48) [Unconjugated]
Immunohistochemistry Synaptotagmin 1 Antibody (ASV48) [Unconjugated]
Immunocytochemistry Synaptotagmin 1 Antibody (ASV48) [Unconjugated]
(1 Publication)
Species: Rt
Applications: ICC, IHC, IP, KO, WB
WNK1 Antibody
[Unconjugated]
AF2849
Western Blot WNK1 Antibody [Unconjugated]
(5 Publications)
Species: Mu, Rt
Applications: WB
GRASP65 Antibody
(OTI5G8)
NBP2-02665
Immunocytochemistry/ Immunofluorescence GRASP65 Antibody (OTI5G8)
Immunocytochemistry/ Immunofluorescence GRASP65 Antibody (OTI5G8)
Flow Cytometry GRASP65 Antibody (OTI5G8)
(3 Reviews)
(2 Publications)
Species: Ca, Hu, Pm, Po, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
c-jun [p Ser63]
Antibody (1018Y) [Unc ...
MAB8930
Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
AKT [p Ser473]
Antibody [Unconjugate ...
AF887
Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
(49 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NIK/MAP3K14
Antibody - BSA Free
NBP2-23603
Immunocytochemistry/ Immunofluorescence NIK/MAP3K14 Antibody - BSA Free
Immunohistochemistry NIK/MAP3K14 Antibody - BSA Free
Western Blot NIK/MAP3K14 Antibody - BSA Free
(1 Publication)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
HGK/MAP4K4
Antibody (4A5)
H00009448-M07
ELISA HGK/MAP4K4 Antibody (4A5)
Immunohistochemistry-Paraffin HGK/MAP4K4 Antibody (4A5)
Western Blot HGK/MAP4K4 Antibody (4A5)
(2 Publications)
Species: Bv, Hu, Pa
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
TRAF-2 Antibody
NB100-56173
Immunocytochemistry/ Immunofluorescence TRAF-2 Antibody
Immunohistochemistry TRAF-2 Antibody
Immunohistochemistry-Paraffin TRAF-2 Antibody
(4 Publications)
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
JNK1 Antibody
(228601) [Unconjugate
MAB17761
Western Blot JNK1 Antibody (228601) [Unconjugated]
Western Blot JNK1 Antibody (228601) [Unconjugated]
Immunocytochemistry JNK1 Antibody (228601) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC, WB
CD40/TNFRSF5
Antibody [Unconjugate
AF632
Agonist Activity CD40/TNFRSF5 Antibody [Unconjugated]
Western Blot CD40/TNFRSF5 Antibody [Unconjugated]
Simple Western CD40/TNFRSF5 Antibody [Unconjugated]
(7 Publications)
Species: Hu
Applications: AgAct, Simple Western, WB

Publications for IKK alpha Protein (NBP1-89634PEP) (0)

There are no publications for IKK alpha Protein (NBP1-89634PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IKK alpha Protein (NBP1-89634PEP) (0)

There are no reviews for IKK alpha Protein (NBP1-89634PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for IKK alpha Protein (NBP1-89634PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional IKK alpha Products

Research Areas for IKK alpha Protein (NBP1-89634PEP)

Find related products by research area.

Blogs on IKK alpha.

Check out the latest blog posts on IKK alpha.
IKK alpha says "no" to NFk beta
The nuclear factor kappa B (NFkB) is a ubiquitous transcription factor essential for the activation of immune and inflammatory responses. NFkB activity is inhibited when it is associated with IkB proteins in the cell cytoplasm. IkB proteins are phosph...  Read full blog post.
Regulating Immune Response Pathways with IKK beta
IKK beta, also known as IKK2, activates the NFkB complex by phosphorylating the NFkB inhibitor, IkBa. Several transcript variants, some protein-coding and some not, have been found for IKKB. The Nuclear Factor-kappa B (NF-kB) family of transcription f...  Read full blog post.
IKK alpha: Roles in Development, B-cell Survival and ESC Differentiation
Inhibitor of nuclear factor kappa-B kinase subunit alpha (IKK1 alpha) is a serine/threonine kinase that forms a complex with IKK beta and NEMO. It plays an essential role in embryonic skin development. Mice with low levels of IKKa show an increase in ...  Read full blog post.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our IKK alpha Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol CHUK