Novus Biologicals products are now on bio-techne.com

FARS2 Recombinant Protein Antigen

Name: FARS2 Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP1-85188PEP
Price: 279 USD

Images

There are currently no images for FARS2 Protein (NBP1-85188PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

FARS2 Recombinant Protein Antigen Summary

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FARS2. Source: E. coli Amino Acid Sequence: GTPLFSVYDNLSPVVTTWQNFDSLLIPADHPSRKKGDNYYLNRTHMLRAHTSAHQWDLLHAGLDAFLVVGDVYRRDQIDSQHYPIFHQLEAVRLFSKHELFAGIKDGES Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	FARS2
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	Antibody Competition 10 - 100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85188. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com For further blocking peptide related information and a protocol, click here.
Theoretical MW	30 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for FARS2 Recombinant Protein Antigen

dJ236A3.1
dJ520B18.2 (FARS1 (phenylalanine-tRNA synthetase))
dJ520B18.2
EC 6.1.1
EC 6.1.1.20
FARS1dJ236A3.1 (phenylalanine-tRNA synthetase)
HSPC320
phenylalanine translase
phenylalanine tRNA ligase 2, mitochondrial
Phenylalanine--tRNA ligase
phenylalanine-tRNA synthetase 1 (mitochondrial)
phenylalanine-tRNA synthetase 2 (mitochondrial)
phenylalanyl-tRNA synthetase 2, mitochondrial
phenylalanyl-tRNA synthetase, mitochondrial
PheRS

Background

Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. This gene encodes a phenylalanine-tRNA synthetase (PheRS) localized to the mitochondrion which consists of a single polypeptide chain, unlike the (alpha-beta)2 structure of the prokaryotic and eukaryotic cytoplasmic forms of PheRS. Structure analysis and catalytic properties indicate mitochondrial PheRSs may constitute a class of PheRS distinct from the enzymes found in prokaryotes and in the eukaryotic cytoplasm. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

GARS Antibody

NBP3-35329

Species: Hu, Mu

Applications: ELISA, ICC/IF, WB

WARS2 Antibody

NBP1-54653

(1 Publication)

Species: Hu

Applications: WB

Seryl tRNA
synthetase Antibody (

H00006301-M01

Immunohistochemistry-Paraffin Seryl tRNA synthetase Antibody (1H4)

Western Blot Seryl tRNA synthetase Antibody (1H4)

(4 Publications)

Species: Hu, Mu, Ze

Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, KD, WB

TARSL2 Antibody

NBP2-56375

Immunocytochemistry/ Immunofluorescence TARSL2 Antibody

Species: Hu

Applications: ICC/IF, IHC, IHC-P

TARS Antibody

NBP2-20567

Immunohistochemistry-Paraffin TARS Antibody

(1 Review)

Species: Hu

Applications: IHC, IHC-P, WB

YARS Antibody

NBP1-86889

Immunohistochemistry-Paraffin YARS Antibody

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, KD, WB

SARS2 Antibody

NBP2-20262

Immunohistochemistry-Paraffin SARS2 Antibody

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

Tyrosinase
Antibody (JA52-11)

NBP2-67232

Immunohistochemistry-Paraffin Tyrosinase Antibody (JA52-11)

Species: Hu, Mu

Applications: ICC/IF, IHC, IHC-P, WB

TARS2 Antibody

NBP1-82294

Immunocytochemistry/ Immunofluorescence TARS2 Antibody

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

Tryptophanyl tRNA
synthetase Antibody ( ...

NBP3-33363

Species: Hu

Applications: ELISA, IHC, IHC-P

Fibrillin 2
Antibody

NBP1-88169

(2 Publications)

Species: Hu

Applications: IHC, IHC-Fr, IHC-P, WB

eEF1A1 Antibody -
Azide and BSA Free

NBP2-92880

Immunohistochemistry-Paraffin eEF1A1 Antibody - Azide and BSA Free

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

HARS Antibody

NBP1-89490

Immunohistochemistry-Paraffin HARS Antibody

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, KD, WB

SLURP1 Antibody

AF4479

(1 Publication)

Species: Hu

Applications: IHC

Alanyl tRNA
synthetase Antibody

NBP3-35492

Species: Hu, Mu, Rt

Applications: ELISA, ICC/IF, IHC, IHC-P, WB

BTG4 Antibody (1A6)

H00054766-M07

Immunocytochemistry/ Immunofluorescence BTG4 Antibody (1A6)

Species: Hu

Applications: ELISA, ICC/IF, WB

VARS Antibody

NBP2-13513

Immunohistochemistry-Paraffin VARS Antibody

Species: Hu

Applications: ICC/IF, IHC, IHC-P, KD, WB

VARS2 Antibody

NBP2-49627

Species: Hu

Applications: IHC, IHC-P, WB

SPAG9 Antibody

NBP1-85393

Immunohistochemistry-Paraffin SPAG9 Antibody

Species: Hu

Applications: ICC/IF, IHC, IHC-P

FARS2 Recombinant
Protein Antigen

NBP1-85188PEP

Species: Hu

Applications: AC

Publications for FARS2 Protein (NBP1-85188PEP) (0)

There are no publications for FARS2 Protein (NBP1-85188PEP).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FARS2 Protein (NBP1-85188PEP) (0)

There are no reviews for FARS2 Protein (NBP1-85188PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for FARS2 Protein (NBP1-85188PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FARS2 Products

Blogs on FARS2

There are no specific blogs for FARS2, but you can read our latest blog posts.

Read our latest blog and use the new citation tool on bio-techne.com

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

Mass

Concentration

Volume

Molecular Weight* g/mol

Review this Product

Be the first to review our FARS2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol

FARS2

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

FARS2 Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

FARS2 Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for FARS2 Recombinant Protein Antigen

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for FARS2 Protein (NBP1-85188PEP) (0)

Reviews for FARS2 Protein (NBP1-85188PEP) (0)

FAQs for FARS2 Protein (NBP1-85188PEP) (0)

Additional FARS2 Products

Blogs on FARS2

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics