Reactivity | HuSpecies Glossary |
Applications | WB |
Clonality | Polyclonal |
Host | Mouse |
Conjugate | Unconjugated |
Immunogen | ESCO1 (AAH36943.1, 1 a.a. - 172 a.a.) full-length human protein. MVLPEDPKYALKKVDEIREMVDNDLGFQQAPLMCYSRTKTLLFISNDKKVVGCLIAEHIQWGYRVIEEKLPVIRSEEEKVRFERQKAWCCSTLPEPAICGISRIWVFSMMRRKKIASRMIECLRSNFIYGSYLSKEEIAFSDPTPDGKLFATQYCGTGQFLVYNFINGQNST |
Specificity | ESCO1 - establishment of cohesion 1 homolog 1 (S. cerevisiae), |
Isotype | IgG |
Clonality | Polyclonal |
Host | Mouse |
Gene | ESCO1 |
Purity | Protein A purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
|
Application Notes | Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. |
|
Publications |
|
Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.4) |
Preservative | No Preservative |
Purity | Protein A purified |
Publication using H00114799-B01P | Applications | Species |
---|---|---|
Price JC, Pollock LM, Rudd ML et al. Sequencing of Candidate Chromosome Instability Genes in Endometrial Cancers Reveals Somatic Mutations in ESCO1, CHTF18, and MRE11A. PLoS One 2013-06-03 [PMID: 23755103] (WB, Human) | WB | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for Eco1 Antibody (H00114799-B01P)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | ESCO1 |
Entrez |
|
Uniprot |
|