Novus Biologicals products are now on bio-techne.com

DORFIN Recombinant Protein Antigen

Images

 
There are currently no images for DORFIN Protein (NBP1-87989PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

DORFIN Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RNF19A.

Source: E. coli

Amino Acid Sequence: EMCTDKNSIFSTNTSSDNGLTSISKQIGDFIECPLCLLRHSKDRFPDIMTCHHRSCVDCL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RNF19A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87989.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for DORFIN Recombinant Protein Antigen

  • DKFZp566B1346
  • dorfin
  • Double ring-finger protein
  • E3 ubiquitin-protein ligase RNF19A
  • EC 6.3.2
  • EC 6.3.2.-
  • p38
  • protein p38 interacting with transcription factor Sp1
  • RING finger protein 19 isoform
  • ring finger protein 19
  • ring finger protein 19Ap38 protein
  • ring-IBR-ring domain containing protein Dorfin
  • RNF19

Background

Dorfin is an E3 ubiquitin ligase which mediates ubiquitination of cellular proteins. Dorfin contains two RING-finger motifs and an IBR (in between RING fingers) motif. Dorfin interacts with UBE2L3/UBCH7 and UBE2E2/UBCH8, but not other ubiquitin-conjugating enzymes. Dorfin is of interest in Parkinson's Disease, as it binds and ubiquitylates synphilin 1 (SNCAIP - interacts with alpha synuclein) in neurons. Furthermore, Dorfin expression is increased in Lewy bodies, the characteristic neuronal inclusions in Parkinson's diseased brains. In normal subjects, Dorfin is widely expressed at low levels with higher levels found in the heart and is ubiquitously expressed in the central nervous system. Alternatively spliced transcript variants encoding the same protein have been reported.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
AF8691
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
NBP2-00764
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
NBP1-81575
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-37568
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP1-68874
Species: Hu, Mu, Rt
Applications: PEP-ELISA, WB
H00010598-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
MAB17761
Species: Hu, Mu, Rt
Applications: ICC, WB
NBP2-24915
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NBP2-13304
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-21037
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-31361
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NBP2-15365
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, S-ELISA, WB
E2-640
Species: Hu, Mu, Rt
Applications: EnzAct
NBP1-04351
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB

Publications for DORFIN Protein (NBP1-87989PEP) (0)

There are no publications for DORFIN Protein (NBP1-87989PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DORFIN Protein (NBP1-87989PEP) (0)

There are no reviews for DORFIN Protein (NBP1-87989PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for DORFIN Protein (NBP1-87989PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DORFIN Products

Research Areas for DORFIN Protein (NBP1-87989PEP)

Find related products by research area.

Blogs on DORFIN

There are no specific blogs for DORFIN, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our DORFIN Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol RNF19A