![Western Blot: CYC1 Antibody [NBP1-86872] - Analysis in human cell lines PC-3 and SK-MEL-30. Corresponding CYC1 RNA-seq data are presented for the same cell lines. Loading control: Anti-HDAC1.](http://images.novusbio.com/fullsize/CYC1-Antibody-Western-Blot-NBP1-86872-img0013.jpg "Western Blot: CYC1 Antibody [NBP1-86872] - Analysis in human cell lines PC-3 and SK-MEL-30. Corresponding CYC1 RNA-seq data are presented for the same cell lines. Loading control: Anti-HDAC1.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: NSEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIAMAPPIYTDVLEFDDGTPATMSQIAKDVCTFLRWASEPEHDHRKRMGLKMLMMMALLVPLVYTIKRHKWSVLKSRKLAYR |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CYC1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | IHC-P reported in scientific literature (PMID: 26481427). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Intracellular Staining by Flow Cytometry Galectin-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Galectin-1_AF1152_Flow_Cytometry_11328.jpg)
![Simple Western Galectin-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Galectin1_AF1152_Simple_Western_16673.jpg)
![Immunohistochemistry Galectin-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Galectin-1_AF1152_Immunohistochemistry_6684.jpg)
| Images | Ratings | Applications | Species | Date | Details | ||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Verified Customer |
ICC | Rat | 12/07/2015 |
Summary
|
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CYC1 |
![Immunocytochemistry/Immunofluorescence: CYC1 Antibody [NBP1-86872] - Staining of human cell line U-251 MG shows localization to mitochondria. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/CYC1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-86872-img0011.jpg "Immunocytochemistry/Immunofluorescence: CYC1 Antibody [NBP1-86872] - Staining of human cell line U-251 MG shows localization to mitochondria. Antibody staining is shown in green.")
![Immunohistochemistry: CYC1 Antibody [NBP1-86872] - Tissue localization and semi-quantification of the mitochondrial respiratory enzyme complexes in the murine distal colon during C. rodentium infection. Immunohistochemical staining using antibodies for CYC1 (complex-III). Statistics: unpaired t test. *P < 0.05, **P < 0.01, ***P < 0.001 vs. control, n = 5-6 mice/group. The infection experiments were performed twice, and each time point contain results pooled from 5-6 mice. Scale bar 100 um, magnification x 200. Image collected and cropped by CiteAb from the following publication (//www.nature.com/articles/srep15434), licensed under a CC-BY license.](http://images.novusbio.com/fullsize/CYC1-Antibody-Immunohistochemistry-NBP1-86872-img0018.jpg "Immunohistochemistry: CYC1 Antibody [NBP1-86872] - Tissue localization and semi-quantification of the mitochondrial respiratory enzyme complexes in the murine distal colon during C. rodentium infection. Immunohistochemical staining using antibodies for CYC1 (complex-III). Statistics: unpaired t test. *P < 0.05, **P < 0.01, ***P < 0.001 vs. control, n = 5-6 mice/group. The infection experiments were performed twice, and each time point contain results pooled from 5-6 mice. Scale bar 100 um, magnification x 200. Image collected and cropped by CiteAb from the following publication (//www.nature.com/articles/srep15434), licensed under a CC-BY license.")
![Western Blot: CYC1 Antibody [NBP1-86872] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize/CYC1-Antibody-Western-Blot-NBP1-86872-img0007.jpg "Western Blot: CYC1 Antibody [NBP1-86872] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.")
![Immunohistochemistry-Paraffin: CYC1 Antibody [NBP1-86872] - Staining of human cerebral cortex shows moderate granular positivity in cytoplasm in neurons.](http://images.novusbio.com/fullsize/CYC1-Antibody-Immunohistochemistry-Paraffin-NBP1-86872-img0014.jpg "Immunohistochemistry-Paraffin: CYC1 Antibody [NBP1-86872] - Staining of human cerebral cortex shows moderate granular positivity in cytoplasm in neurons.")
![Immunohistochemistry-Paraffin: CYC1 Antibody [NBP1-86872] - Staining of human duodenum shows strong granular positivity in cytoplasm in glandular cells.](http://images.novusbio.com/fullsize/CYC1-Antibody-Immunohistochemistry-Paraffin-NBP1-86872-img0015.jpg "Immunohistochemistry-Paraffin: CYC1 Antibody [NBP1-86872] - Staining of human duodenum shows strong granular positivity in cytoplasm in glandular cells.")
![Immunohistochemistry-Paraffin: CYC1 Antibody [NBP1-86872] - Staining of human kidney shows strong granular positivity in cytoplasm in cells in tubules.](http://images.novusbio.com/fullsize/CYC1-Antibody-Immunohistochemistry-Paraffin-NBP1-86872-img0016.jpg "Immunohistochemistry-Paraffin: CYC1 Antibody [NBP1-86872] - Staining of human kidney shows strong granular positivity in cytoplasm in cells in tubules.")
![Immunohistochemistry-Paraffin: CYC1 Antibody [NBP1-86872] - Staining of human skeletal muscle shows moderate granular positivity in cytoplasm in myocytes.](http://images.novusbio.com/fullsize/CYC1-Antibody-Immunohistochemistry-Paraffin-NBP1-86872-img0017.jpg "Immunohistochemistry-Paraffin: CYC1 Antibody [NBP1-86872] - Staining of human skeletal muscle shows moderate granular positivity in cytoplasm in myocytes.")
![Immunohistochemistry Galectin-4 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af2128_mouse-galectin-4-affinity-purified-polyclonal-ab-immunohistochemistry-29122022154254.jpg)
![Western Blot Galectin-10 Antibody [Unconjugated]](https://images.novusbio.com/images2/Galectin-10_AF5447_Western_Blot_5721.jpg)
![Intracellular Staining by Flow Cytometry Galectin-10 Antibody [Unconjugated]](https://images.novusbio.com/images2/Galectin-10_AF5447_Flow_Cytometry_8273.jpg)
![Intracellular Staining by Flow Cytometry Galectin-10 Antibody [Unconjugated]](https://images.novusbio.com/images2/af5447_human-galectin-10-affinity-purified-polyclonal-ab-flow-cytometry-2162021133613.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
