Home » CD133 » CD133 Proteins » CD133 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

CD133 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for CD133 Recombinant Protein Antigen (NBP2-59787PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

CD133 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CD133

Source: E. coli

Amino Acid Sequence: QYNTTKDKAFTDLNSINSVLGGGILDRLRPNIIPVLDEIKSMATAIKETKEALENMNSTLKSLHQQSTQLSSSLTSVKTSLRSSLNDPLCLVHPSSETCNSIRLSLS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PROM1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-59787.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.
Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CD133 Recombinant Protein Antigen

  • AC133 Stargardt disease 4 (autosomal dominant)
  • AC133
  • CD133 retinal 2
  • CD133
  • PROM1
  • prominin (mouse)-like 1
  • Prominin 1
  • PROML1

Background

Prominin 1 (CD133) is expressed on primitive hematopoietic stem and progenitor cells, retinoblastoma, hemangioblasts, and neural stem cells as well as on developing epithelium. The CD133 positive fraction of human bone marrow, cord blood and peripheral blood have been shown to efficiently engraft in xenotransplantation models, and have been shown to contain the majority of the granulocyte/macrophage precursors, NOD/SCID repopulating cells and CD34 + dendritic cell precursors.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NOD2 Antibody
(2D9) - BSA Free
NB100-524
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Immunohistochemistry-Frozen NOD2 Antibody (2D9) - BSA Free
(1 Review)
(26 Publications)
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
CTLA-4
[Unconjugated]
7268-CT
Bioactivity CTLA-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
HLA DQ/DR/DP
Antibody (HLA-Pan/296 ...
NBP2-79843
Protein Array HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Western Blot HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
CD34 Antibody
[Unconjugated]
AF4117
Immunohistochemistry CD34 Antibody [Unconjugated]
(3 Reviews)
(37 Publications)
Species: Rt
Applications: IHC, WB
CD44 Antibody
(2C5) [Unconjugated] ...
BBA10
Simple Western CD44 Antibody (2C5) [Unconjugated] - s Pan Specific
Western Blot CD44 Antibody (2C5) [Unconjugated] - s Pan Specific
Immunohistochemistry CD44 Antibody (2C5) [Unconjugated] - s Pan Specific
(5 Reviews)
(49 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
VEGF [HRP]
DVE00
N/A VEGF [HRP]
N/A VEGF [HRP]
N/A VEGF [HRP]
(681 Publications)
Species: Hu
Applications: ELISA
VEGFR2/KDR/Flk-1
Antibody [Unconjugate ...
AF644
Neutralization VEGFR2/KDR/Flk-1 Antibody [Unconjugated]
Immunohistochemistry VEGFR2/KDR/Flk-1 Antibody [Unconjugated]
Immunohistochemistry VEGFR2/KDR/Flk-1 Antibody [Unconjugated]
(3 Reviews)
(97 Publications)
Species: Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Neut, WB
CD45 Antibody
[Unconjugated]
AF114
Immunohistochemistry CD45 Antibody [Unconjugated]
Immunocytochemistry CD45 Antibody [Unconjugated]
Immunocytochemistry/ Immunofluorescence CD45 Antibody [Unconjugated]
(1 Review)
(70 Publications)
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
CD117/c-kit
Antibody [Unconjugate
AF1356
Simple Western CD117/c-kit Antibody [Unconjugated]
Western Blot CD117/c-kit Antibody [Unconjugated]
Immunohistochemistry CD117/c-kit Antibody [Unconjugated]
(4 Reviews)
(116 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Simple Western, WB
Nestin Antibody
(196908) [Unconjugate
MAB1259
Immunocytochemistry Nestin Antibody (196908) [Unconjugated]
Intracellular Staining by Flow Cytometry Nestin Antibody (196908) [Unconjugated]
Western Blot Nestin Antibody (196908) [Unconjugated]
(3 Reviews)
(160 Publications)
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow
Oct-3/4 Antibody
[Unconjugated]
AF1759
Chromatin Immunoprecipitation (ChIP) Oct-3/4 Antibody [Unconjugated]
Immunocytochemistry Oct-3/4 Antibody [Unconjugated]
Simple Western Oct-3/4 Antibody [Unconjugated]
(75 Publications)
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
CD31/PECAM-1
Antibody [Unconjugate
AF3628
Immunohistochemistry CD31/PECAM-1 Antibody [Unconjugated]
Flow Cytometry CD31/PECAM-1 Antibody [Unconjugated]
Immunohistochemistry CD31/PECAM-1 Antibody [Unconjugated]
(6 Reviews)
(491 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Hemoglobin alpha
Antibody - BSA Free
NB110-41083
Hemoglobin alpha Antibody - BSA Free
(12 Publications)
Species: Hu
Applications: ChIP, ELISA, ICC/IF, WB
CD24 Antibody
(ML5) - BSA Free
NB100-77903
Flow Cytometry CD24 Antibody (ML5) - BSA Free
Flow Cytometry CD24 Antibody (ML5) - BSA Free
Immunocytochemistry/ Immunofluorescence CD24 Antibody (ML5) - BSA Free
(1 Publication)
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-Fr
CD90/Thy1 Antibody
AF2067
Flow Cytometry CD90/Thy1 Antibody
Flow Cytometry CD90/Thy1 Antibody
Flow Cytometry CD90/Thy1 Antibody
(1 Review)
(13 Publications)
Species: Ca, Hu, Po
Applications: CyTOF-ready, Flow, ICC, IHC, WB
CXCR4 Antibody
(44716) [Unconjugated
MAB172
Immunohistochemistry CXCR4 Antibody (44716) [Unconjugated]
Neutralization CXCR4 Antibody (44716) [Unconjugated]
Immunohistochemistry CXCR4 Antibody (44716) [Unconjugated]
(2 Reviews)
(87 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut
Endoglin/CD105
Antibody [Unconjugate
AF1320
Immunocytochemistry Endoglin/CD105 Antibody [Unconjugated]
Immunocytochemistry Endoglin/CD105 Antibody [Unconjugated]
Simple Western Endoglin/CD105 Antibody [Unconjugated]
(2 Reviews)
(43 Publications)
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
ABCG2/CD338
Antibody (3G8) - BSA
NBP2-22124
ELISA ABCG2/CD338 Antibody (3G8) - BSA Free
Flow Cytometry ABCG2/CD338 Antibody (3G8) - BSA Free
Immunocytochemistry/ Immunofluorescence ABCG2/CD338 Antibody (3G8) - BSA Free
(8 Publications)
Species: Hu, Mu, Pm
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
GFAP Antibody
NB300-141
Immunohistochemistry GFAP Antibody
Western Blot GFAP Antibody
Western Blot GFAP Antibody
(12 Reviews)
(108 Publications)
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
CD133 Recombinant
Protein Antigen
NBP2-59787PEP
CD133 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for CD133 Recombinant Protein Antigen (NBP2-59787PEP) (0)

There are no publications for CD133 Recombinant Protein Antigen (NBP2-59787PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD133 Recombinant Protein Antigen (NBP2-59787PEP) (0)

There are no reviews for CD133 Recombinant Protein Antigen (NBP2-59787PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CD133 Recombinant Protein Antigen (NBP2-59787PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CD133 Products

Research Areas for CD133 Recombinant Protein Antigen (NBP2-59787PEP)

Find related products by research area.

Blogs on CD133.

Check out the latest blog posts on CD133.
Stemness is responsible for onset and metastasis of colorectal cancer
By Jamshed Arslan, Pharm. D., PhD. Colorectal cancer stem cells are a rare subpopulation of colorectal cancer cells that can self-renew and initiate and sustain tumor growth when transplanted into an animal host.1,2 C...  Read full blog post.
ATG9A - early marker autophagosome assembly
ATG9A is the only essential integral membrane protein involved in autophagy. ATG9A contains six transmembrane domains and initiates the assembly of autophagosomes. The autophagosome is a double-membrane structure that engulfs and eventually degrade...  Read full blog post.
CD133
Also known as PROM1 and AC133, this gene is located on chromosome 4p15 and encodes CD133, a 120kDa pentaspan transmembrane glycoprotein (5-TM) and presents multiple spliced variants. Prominin-1 (CD133) was the first protein identified as "Prominin"; o...  Read full blog post.
CD Antibodies Uncover Markers for Rare Breast Cancer
We at Novus Biologicals have added several new products to our CD antibody database. The CD, or Cluster of Differential proteins are a family of type I transmembrane glycoproteins widely expressed in immune cell populations. These include B cells, thy...  Read full blog post.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CD133 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol PROM1