![Western Blot: CARD10 Antibody [NBP2-92911] - Western blot analysis of extracts of Mouse kidney, using CARD10 antibody (NBP2-92911) at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.](http://images.novusbio.com/fullsize/CARD10-Antibody-Western-Blot-NBP2-92911-img0003.jpg "Western Blot: CARD10 Antibody [NBP2-92911] - Western blot analysis of extracts of Mouse kidney, using CARD10 antibody (NBP2-92911) at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 863-1032 of human CARD10 (NP_055365.2). LLDLPSSRLDFQVCPAESLSGEELCPSSAPGAPKAQPATPGLGSRIRAIQESVGKKHCLLELGARGVRELVQNEIYPIVIHVEVTEKNVREVRGLLGRPGWRDSELLRQCRGSEQVLWGLPCSWVQVPAHEWGHAEELAKVVRGRILQEQARLVWVECGSSRGCPSSSEA |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CARD10 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS with 50% glycerol, pH7.3. |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Neutralization CXCL8/IL-8 Antibody (6217) [Unconjugated]](https://images.novusbio.com/images2/CXCL8_MAB208_Block_Neutralize_9064.jpg)
![Immunocytochemistry CXCL8/IL-8 Antibody (6217) [Unconjugated]](https://images.novusbio.com/images2/CXCL8_MAB208_Immunocytochemistry_9339.jpg)
![Western Blot CXCL8/IL-8 Antibody (6217) [Unconjugated]](https://images.novusbio.com/images2/mab208_human-il-8-cxcl8-mab-clone-6217-western-blot-1882021143847.jpg)
![Immunohistochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunohistochemistry_20892.jpg)
![Immunocytochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunocytochemistry__Immunofluorescence_21143.jpg)
![Western Blot EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Western_Blot_19925.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for CARD10 Antibody (NBP2-92911)Find related products by research area.
|
|
Toll-like receptor 2 activation contributes to oral squamous cell carcinoma development and miRNA-mediated drug resistance By Jamshed Arslan, Pharm. D., PhD. Squamous cell carcinoma is the most common cancer in the oral cavity.1 The tumor surface biofilms in oral cancers contain high levels of aerobic and anaerobic microorganisms.1,2 Peri... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CARD10 |
![Immunohistochemistry-Paraffin: CARD10 Antibody [NBP2-92911] - Paraffin-embedded mouse kidney using CARD10 .](http://images.novusbio.com/fullsize/CARD10-Antibody-Immunohistochemistry-Paraffin-NBP2-92911-img0002.jpg "Immunohistochemistry-Paraffin: CARD10 Antibody [NBP2-92911] - Paraffin-embedded mouse kidney using CARD10 .")
![Western Blot: CARD10 Antibody [NBP2-92911] - Western blot analysis of extracts of Rat kidney, using CARD10 antibody (NBP2-92911) at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.](http://images.novusbio.com/fullsize/CARD10 Antibody-Western Blot-NBP2-92911-img0004.jpg "Western Blot: CARD10 Antibody [NBP2-92911] - Western blot analysis of extracts of Rat kidney, using CARD10 antibody (NBP2-92911) at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.")
![Immunohistochemistry-Paraffin: CARD10 Antibody [NBP2-92911] - Paraffin-embedded human liver damage using CARD10 .](http://images.novusbio.com/fullsize/CARD10-Antibody-Immunohistochemistry-Paraffin-NBP2-92911-img0001.jpg "Immunohistochemistry-Paraffin: CARD10 Antibody [NBP2-92911] - Paraffin-embedded human liver damage using CARD10 .")
![Flow Cytometry Lgr6 Antibody (918719) [Unconjugated]](https://images.novusbio.com/images2/Lgr6_MAB8458_Flow_Cytometry_16097.jpg)
![Immunocytochemistry Lgr6 Antibody (918719) [Unconjugated]](https://images.novusbio.com/images2/Lgr6_MAB8458_Immunocytochemistry_16415.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")