Novus Biologicals products are now on bio-techne.com

Acetyl-CoA Carboxylase alpha/ACACA Recombinant Protein Antigen

Images

 
There are currently no images for Acetyl-CoA Carboxylase alpha/ACACA Recombinant Protein Antigen (NBP2-38981PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Acetyl-CoA Carboxylase alpha/ACACA Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ACACA.

Source: E. coli

Amino Acid Sequence: MDEPSPLAQPLELNQHSRFIIGSVSEDNSEDEISNLVKLDLLEEKEGSLSPASVGSDTLSDL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ACACA
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38981.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Acetyl-CoA Carboxylase alpha/ACACA Recombinant Protein Antigen

  • ACACA
  • ACACacetyl-CoA carboxylase 1
  • ACC1
  • ACC1ACC
  • ACCA
  • ACC-alpha
  • AcetylCoA Carboxylase alpha
  • Acetyl-CoA Carboxylase alpha
  • acetyl-Coenzyme A carboxylase alpha
  • EC 6.4.1.2

Background

Acetyl-CoA carboxylase 1 (ACC1) is a biotin dependent lipogenic enzyme that is highly expressed during adipogenesis. ACC1 catalyzes acetyl-CoA carboxylation, producing malonyl-CoA, a metabolite involved in energy homeostasis regulation. Malonyl-CoA is a two carbon donor in the synthesis of long-chain fatty acids and the elongation of fatty acids found in the cystol (1). ACC1 is regulated short-term by citrate, CoA, and palmitoyl-CoA through allosteric interactions. Nutrients and hormones can be both short-term (inducing reversible phosphorylations by such as AMPK) and long-term (transcription level regulation) regulators of ACC1 (2). Highly expressed in lipogenic tissues, ACC1 is found in liver, adipose, and lactating mammary gland (3). ACC1 has been implicated as a target in the development of anti-obesity drugs (4).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB400-114
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
NBP2-22127
Species: Hu, Mu, Pm, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
AF2850
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
AF2854
Species: Hu, Mu, Rt
Applications: IHC, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NB120-13550
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-90274
Species: Hu
Applications: IHC, IHC-P, WB
DY417
Species: Mu
Applications: ELISA
NB600-582
Species: Ca, Ch, SyHa, Ha, Hu, Pm, Mu, Rt
Applications: IHC-Fr, KO, Simple Western, WB
NB100-309
Species: Hu, Pm, Mu, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KD, PAGE, Single-Cell Western, WB
MAB1266
Species: Hu
Applications: CyTOF-ready, IP, ICFlow, WB
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
AF7550
Species: Hu
Applications: KO, WB
AF7197
Species: Hu, Mu
Applications: ICC, IHC, WB
NBP1-49533
Species: Hu, Mu, Pl, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, KD, WB
NBP2-34294
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
DLP00
Species: Hu
Applications: ELISA
NBP1-90276
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-38981PEP
Species: Hu
Applications: AC

Publications for Acetyl-CoA Carboxylase alpha/ACACA Recombinant Protein Antigen (NBP2-38981PEP) (0)

There are no publications for Acetyl-CoA Carboxylase alpha/ACACA Recombinant Protein Antigen (NBP2-38981PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Acetyl-CoA Carboxylase alpha/ACACA Recombinant Protein Antigen (NBP2-38981PEP) (0)

There are no reviews for Acetyl-CoA Carboxylase alpha/ACACA Recombinant Protein Antigen (NBP2-38981PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Acetyl-CoA Carboxylase alpha/ACACA Recombinant Protein Antigen (NBP2-38981PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Acetyl-CoA Carboxylase alpha/ACACA Products

Research Areas for Acetyl-CoA Carboxylase alpha/ACACA Recombinant Protein Antigen (NBP2-38981PEP)

Find related products by research area.

Blogs on Acetyl-CoA Carboxylase alpha/ACACA

There are no specific blogs for Acetyl-CoA Carboxylase alpha/ACACA, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Acetyl-CoA Carboxylase alpha/ACACA Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ACACA