Home » Acetyl-CoA Carboxylase alpha/ACACA » ACACA Peptides and Proteins » Recombinant Human Acetyl-CoA Carboxylase alpha/ACACA GST (N-Term) Protein
Novus Biologicals products are now on bio-techne.com

Recombinant Human Acetyl-CoA Carboxylase alpha/ACACA GST (N-Term) Protein

 Submit a Review

Images

 
(
Enlarge)
SDS-Page: Recombinant Human Acetyl-CoA Carboxylase alpha/ACACA Protein [H00000031-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.
SDS-Page: Recombinant Human Acetyl-CoA Carboxylase alpha/ACACA Protein [H00000031-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, PAGE, AP

Order Details

100% Guarantee on every product

Recombinant Human Acetyl-CoA Carboxylase alpha/ACACA GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-99 of Human Acetyl-CoA Carboxylase alpha/ACACA

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MWWSTLMSILRARSFWKWISTQTVRIIRAVRAHFGGIMDEPSPLAQPLELNQHSRFIIGSVSEDNSEDEISNLVKLDLLEEKEGSLSPASVGSDTLSDL
Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
ACACA
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
36.63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Acetyl-CoA Carboxylase alpha/ACACA GST (N-Term) Protein

  • ACACA
  • ACACacetyl-CoA carboxylase 1
  • ACC1
  • ACC1ACC
  • ACCA
  • ACC-alpha
  • AcetylCoA Carboxylase alpha
  • Acetyl-CoA Carboxylase alpha
  • acetyl-Coenzyme A carboxylase alpha
  • EC 6.4.1.2

Background

ACACA - acetyl-Coenzyme A carboxylase alpha

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Fatty Acid
Synthase/FASN Antibod
NB400-114
Immunocytochemistry/ Immunofluorescence Fatty Acid Synthase/FASN Antibody
Western Blot Fatty Acid Synthase/FASN Antibody
Immunohistochemistry-Paraffin Fatty Acid Synthase/FASN Antibody
(2 Reviews)
(24 Publications)
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
AMPK alpha 1
Antibody (2B7) - BSA
NBP2-22127
Flow Cytometry AMPK alpha 1 Antibody (2B7) - BSA Free
Flow Cytometry AMPK alpha 1 Antibody (2B7) - BSA Free
ELISA AMPK alpha 1 Antibody (2B7) - BSA Free
(12 Publications)
Species: Hu, Mu, Pm, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
AMPK alpha 2
Antibody [Unconjugate
AF2850
Western Blot AMPK alpha 2 Antibody [Unconjugated]
Simple Western AMPK alpha 2 Antibody [Unconjugated]
Immunocytochemistry AMPK alpha 2 Antibody [Unconjugated]
(11 Publications)
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
AMPK beta 1
Antibody [Unconjugate
AF2854
Western Blot AMPK beta 1 Antibody [Unconjugated]
Immunohistochemistry AMPK beta 1 Antibody [Unconjugated]
Immunohistochemistry AMPK beta 1 Antibody [Unconjugated]
(2 Publications)
Species: Hu, Mu, Rt
Applications: IHC, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Fas/TNFRSF6/CD95
Antibody - BSA Free
NB120-13550
Immunocytochemistry/ Immunofluorescence Fas/TNFRSF6/CD95 Antibody - BSA Free
Western Blot Fas/TNFRSF6/CD95 Antibody - BSA Free
Immunohistochemistry-Paraffin Fas/TNFRSF6/CD95 Antibody - BSA Free
(1 Review)
(4 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Acetyl Coenzyme A
Carboxylase Beta Anti ...
NBP1-90274
Immunohistochemistry-Paraffin Acetyl Coenzyme A Carboxylase Beta Antibody
Immunohistochemistry-Paraffin Acetyl Coenzyme A Carboxylase Beta Antibody
Immunohistochemistry-Paraffin Acetyl Coenzyme A Carboxylase Beta Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
IL-10 [Biotin]
DY417
N/A IL-10 [Biotin]
(287 Publications)
Species: Mu
Applications: ELISA
SREBP1 Antibody
(2A4) - BSA Free
NB600-582
Western Blot SREBP1 Antibody (2A4) - BSA Free
Knockout Validated SREBP1 Antibody (2A4) - BSA Free
Western Blot SREBP1 Antibody (2A4) - BSA Free
(60 Publications)
Species: Ca, Ch, SyHa, Ha, Hu, Pm, Mu, Rt
Applications: IHC-Fr, KO, Simple Western, WB
ATM Antibody (2C1)
NB100-309
Knockdown Validated ATM Antibody (2C1)
Knockdown Validated ATM Antibody (2C1)
Immunoprecipitation ATM Antibody (2C1)
(3 Reviews)
(130 Publications)
Species: Hu, Pm, Mu, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KD, PAGE, Single-Cell Western, WB
Serpin A5/Protein
C Inhibitor Antibody ...
MAB1266
Intracellular Staining by Flow Cytometry Serpin A5/Protein C Inhibitor Antibody (210326) [Unconjugated]
(2 Publications)
Species: Hu
Applications: CyTOF-ready, IP, ICFlow, WB
PPAR gamma/NR1C3
Antibody - BSA Free
NBP2-22106
Western Blot PPAR gamma/NR1C3 Antibody - BSA Free
Immunohistochemistry-Paraffin PPAR gamma/NR1C3 Antibody - BSA Free
Western Blot PPAR gamma/NR1C3 Antibody - BSA Free
(2 Reviews)
(9 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
SCD-1 Antibody
[Unconjugated]
AF7550
Western Blot SCD-1 Antibody [Unconjugated]
Knockout Validated SCD-1 Antibody [Unconjugated]
(1 Review)
Species: Hu
Applications: KO, WB
Lipoprotein
Lipase/LPL Antibody [ ...
AF7197
Immunohistochemistry Lipoprotein Lipase/LPL Antibody [Unconjugated]
Western Blot Lipoprotein Lipase/LPL Antibody [Unconjugated]
Immunocytochemistry Lipoprotein Lipase/LPL Antibody [Unconjugated]
(11 Publications)
Species: Hu, Mu
Applications: ICC, IHC, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(803 Publications)
Species: Hu
Applications: BA
Glut4 Antibody -
BSA Free
NBP1-49533
Flow (Intracellular) Glut4 Antibody - BSA Free
Western Blot Glut4 Antibody - BSA Free
Western Blot Glut4 Antibody - BSA Free
(4 Reviews)
(36 Publications)
Species: Hu, Mu, Pl, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, KD, WB
Thyroglobulin
Antibody (2H11 + 6E1)
NBP2-34294
Immunohistochemistry-Paraffin Thyroglobulin Antibody (2H11 + 6E1)
Immunohistochemistry Thyroglobulin Antibody (2H11 + 6E1)
Immunohistochemistry-Paraffin Thyroglobulin Antibody (2H11 + 6E1)
(3 Reviews)
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
Leptin/OB [HRP]
DLP00
N/A Leptin/OB [HRP]
N/A Leptin/OB [HRP]
(150 Publications)
Species: Hu
Applications: ELISA
Acetyl CoA
synthetase Antibody
NBP1-90276
Immunohistochemistry-Paraffin Acetyl CoA synthetase Antibody
Immunohistochemistry-Paraffin Acetyl CoA synthetase Antibody
Immunohistochemistry-Paraffin Acetyl CoA synthetase Antibody
(2 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Recombinant Human
Acetyl-CoA Carboxylas ...
H00000031-Q01
Recombinant Human Acetyl-CoA Carboxylase alpha/ACACA GST (N-Term) Protein
Species: Hu
Applications: WB, ELISA, MA, PAGE, AP

Publications for Acetyl-CoA Carboxylase alpha/ACACA Partial Recombinant Protein (H00000031-Q01) (0)

There are no publications for Acetyl-CoA Carboxylase alpha/ACACA Partial Recombinant Protein (H00000031-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Acetyl-CoA Carboxylase alpha/ACACA Partial Recombinant Protein (H00000031-Q01) (0)

There are no reviews for Acetyl-CoA Carboxylase alpha/ACACA Partial Recombinant Protein (H00000031-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Acetyl-CoA Carboxylase alpha/ACACA Partial Recombinant Protein (H00000031-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Acetyl-CoA Carboxylase alpha/ACACA Products

Research Areas for Acetyl-CoA Carboxylase alpha/ACACA Partial Recombinant Protein (H00000031-Q01)

Find related products by research area.

Blogs on Acetyl-CoA Carboxylase alpha/ACACA

There are no specific blogs for Acetyl-CoA Carboxylase alpha/ACACA, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Acetyl-CoA Carboxylase alpha/ACACA GST (N-Term) Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol ACACA