Home » LBX1 » LBX1 Proteins » LBX1 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

LBX1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for LBX1 Recombinant Protein Antigen (NBP2-55646PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

LBX1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LBX1.

Source: E. coli

Amino Acid Sequence: ITWFQNRRAKLKRDLEEMKADVESAKKLGPSGQMDIVALAELEQNSEATAGGGGGCGRAKSRPGSPVLPPGAPKAPGAGALQLSPASPLTDQPASSQDCSEDEEDEEIDVD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
LBX1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55646.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.
Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for LBX1 Recombinant Protein Antigen

  • homeobox
  • HPX6
  • HPX-6
  • ladybird homeobox 1
  • ladybird homeobox homolog 1 (Drosophila)
  • ladybird homeobox homolog 1
  • Ladybird homeobox protein homolog 1
  • LBX1Hlady bird-like homeobox
  • transcription factor LBX1
  • transcription factor similar to D. melanogaster homeodomain protein lady birdlate

Background

LBX1 and the orthologous mouse gene were found by their homology to the Drosophila lady bird early and late homeobox genes. In the mouse, this gene is a key regulator of muscle precursor cell migration and is required for the acquisition of dorsal identities of forelimb muscles. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Pax3/Pax7 Antibody
(274212) [Unconjugate ...
MAB2457
Immunocytochemistry Pax3/Pax7 Antibody (274212) [Unconjugated]
Immunocytochemistry/ Immunofluorescence Pax3/Pax7 Antibody (274212) [Unconjugated]
(1 Review)
(18 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow, WB
MYF-5 Antibody
(OTI2G5)
NBP2-44245
Western Blot MYF-5 Antibody (OTI2G5)
Immunohistochemistry-Paraffin MYF-5 Antibody (OTI2G5)
Immunohistochemistry-Paraffin MYF-5 Antibody (OTI2G5)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
MyoD Antibody
(5.8A) - BSA Free
NB100-56511
Immunocytochemistry/ Immunofluorescence MyoD Antibody (5.8A) - BSA Free
Immunocytochemistry/ Immunofluorescence MyoD Antibody (5.8A) - BSA Free
Western Blot MyoD Antibody (5.8A) - BSA Free
(2 Reviews)
(27 Publications)
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, WB
HGFR/c-MET
Antibody [Unconjugate
AF276
Immunocytochemistry HGFR/c-MET Antibody [Unconjugated]
Immunohistochemistry HGFR/c-MET Antibody [Unconjugated]
Knockout Validated HGFR/c-MET Antibody [Unconjugated]
(1 Review)
(53 Publications)
Species: Hu
Applications: Block, CyTOF-ready, Flow, ICC, IHC, KO, Simple Western, WB
HGF [Unconjugated]
294-HG
Bioactivity HGF [Unconjugated]
Cell Culture HGF [Unconjugated]
(113 Publications)
Species: Hu
Applications: BA
Pax7 Antibody
(PAX7) [Unconjugated]
MAB1675
Immunocytochemistry Pax7 Antibody (PAX7) [Unconjugated]
Immunocytochemistry Pax7 Antibody (PAX7) [Unconjugated]
Immunohistochemistry Pax7 Antibody (PAX7) [Unconjugated]
(1 Review)
(48 Publications)
Species: Ch, Hu, Mu, Rt
Applications: ICC, IHC
PITX2 Antibody
[Unconjugated]
AF7388
Immunohistochemistry PITX2 Antibody [Unconjugated]
(8 Publications)
Species: Hu
Applications: IHC
Pax2 Antibody
[Unconjugated]
AF3364
Immunocytochemistry Pax2 Antibody [Unconjugated]
Western Blot Pax2 Antibody [Unconjugated]
Immunohistochemistry Pax2 Antibody [Unconjugated]
(27 Publications)
Species: Hu
Applications: ICC, IHC, WB
LBX2 Antibody (3A5)
H00085474-M02
Immunocytochemistry/ Immunofluorescence LBX2 Antibody (3A5)
Western Blot LBX2 Antibody (3A5)
Sandwich ELISA LBX2 Antibody (3A5)
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
SOS1 Antibody
(SOS-01) - BSA Free
NB110-68800
Western Blot SOS1 Antibody (SOS-01) - BSA Free
Immunocytochemistry/ Immunofluorescence SOS1 Antibody (SOS-01) - BSA Free
Immunocytochemistry/ Immunofluorescence SOS1 Antibody (SOS-01) - BSA Free
Species: Hu, Mu
Applications: ICC/IF, WB
TLX3 Antibody (2A3)
H00030012-M01
Western Blot TLX3 Antibody (2A3)
Sandwich ELISA TLX3 Antibody (2A3)
Western Blot TLX3 Antibody (2A3)
Species: Hu
Applications: ELISA, KD, S-ELISA, WB
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(645 Publications)
Species: Mu
Applications: ELISA
Myogenin Antibody
(671037)
MAB66861
Western Blot Myogenin Antibody (671037)
Immunocytochemistry Myogenin Antibody (671037)
(1 Review)
(3 Publications)
Species: Hu
Applications: ICC, WB
HOX11 Antibody
NB100-56424
Western Blot HOX11 Antibody
Species: Hu, Mu, Rt
Applications: WB
SHFM3 Antibody
NBP2-14013
Immunohistochemistry-Paraffin SHFM3 Antibody
Immunohistochemistry-Paraffin SHFM3 Antibody
Immunohistochemistry-Paraffin SHFM3 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
MEOX 2 Antibody
(6A5)
H00004223-M03
Western Blot MEOX 2 Antibody (6A5)
ELISA MEOX 2 Antibody (6A5)
Immunocytochemistry/ Immunofluorescence MEOX 2 Antibody (6A5)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
TBX1 Antibody
(OTI1C2)
NBP2-46076
Western Blot TBX1 Antibody (OTI1C2)
Immunohistochemistry-Paraffin TBX1 Antibody (OTI1C2)
(1 Publication)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
LBX1 Recombinant
Protein Antigen
NBP2-55646PEP
LBX1 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for LBX1 Recombinant Protein Antigen (NBP2-55646PEP) (0)

There are no publications for LBX1 Recombinant Protein Antigen (NBP2-55646PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LBX1 Recombinant Protein Antigen (NBP2-55646PEP) (0)

There are no reviews for LBX1 Recombinant Protein Antigen (NBP2-55646PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for LBX1 Recombinant Protein Antigen (NBP2-55646PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional LBX1 Products

Array NBP2-55646PEP

Blogs on LBX1

There are no specific blogs for LBX1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our LBX1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol LBX1