![Western Blot: LBX2 Antibody (3A5) [H00085474-M02] - Analysis of LBX2 expression in transfected 293T cell line by LBX2 monoclonal antibody (M02), clone 3A5.Lane 1: LBX2 transfected lysate (Predicted MW: 21.4 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/LBX2-Antibody-3A5-Western-Blot-H00085474-M02-img0005.jpg "Western Blot: LBX2 Antibody (3A5) [H00085474-M02] - Analysis of LBX2 expression in transfected 293T cell line by LBX2 monoclonal antibody (M02), clone 3A5.Lane 1: LBX2 transfected lysate (Predicted MW: 21.4 KDa).Lane 2: Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, ICC/IF |
| Clone | 3A5 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | LBX2 (NP_001009812.1, 95 a.a. ~ 194 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ELERRFVFQKYLAPSERDGLATRLGLANAQVVTWFQNRRAKLKRDVEEMRADVASLRALSPEVLCSLALPEGAPDPGLCLGPAGPDSRPHLSDEEIQVDD |
| Specificity | LBX2 - ladybird homeobox homolog 2 (Drosophila) (3A5) |
| Isotype | IgG2a Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | LBX2 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. Has also been used for immunofluorescence. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | LBX2 |
| Entrez |
|
| Uniprot |
|
![Immunocytochemistry/Immunofluorescence: LBX2 Antibody (3A5) [H00085474-M02] - Analysis of monoclonal antibody to LBX2 on HeLa cell . Antibody concentration 10 ug/ml.](http://images.novusbio.com/fullsize/LBX2-Antibody-3A5-Immunocytochemistry-Immunofluorescence-H00085474-M02-img0003.jpg "Immunocytochemistry/Immunofluorescence: LBX2 Antibody (3A5) [H00085474-M02] - Analysis of monoclonal antibody to LBX2 on HeLa cell . Antibody concentration 10 ug/ml.")
![Sandwich ELISA: LBX2 Antibody (3A5) [H00085474-M02] - Detection limit for recombinant GST tagged LBX2 is 0.03 ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/LBX2-Antibody-3A5-Sandwich-ELISA-H00085474-M02-img0004.jpg "Sandwich ELISA: LBX2 Antibody (3A5) [H00085474-M02] - Detection limit for recombinant GST tagged LBX2 is 0.03 ng/ml as a capture antibody.")
![Western Blot NKX2.5 Antibody [Unconjugated]](https://images.novusbio.com/images/af2444_human-nkx2-5-affinity-purified-polyclonal-ab-4120241239327.jpg)
![Immunocytochemistry/ Immunofluorescence NKX2.5 Antibody [Unconjugated]](https://images.novusbio.com/images/af2444_human-nkx2-5-affinity-purified-polyclonal-ab-41202412401270.jpg)
![Immunocytochemistry/ Immunofluorescence NKX2.5 Antibody [Unconjugated]](https://images.novusbio.com/images/af2444_human-nkx2-5-affinity-purified-polyclonal-ab-41202412403531.jpg)
![Wnt-5b [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Wnt-5b [Unconjugated]")
