Home » HEY1 » HEY1 Proteins » HEY1 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

HEY1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for HEY1 Recombinant Protein Antigen (NBP2-56068PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

HEY1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HEY1.

Source: E. coli

Amino Acid Sequence: MKRAHPEYSSSDSELDETIEVEKESADENGNLSSALGSMSPTTSSQILARKR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
HEY1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56068.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.
Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for HEY1 Recombinant Protein Antigen

  • basic helix-loop-helix protein OAF1
  • BHLHb31
  • Cardiovascular helix-loop-helix factor 2
  • CHF-2
  • CHF2hHRT1
  • Class B basic helix-loop-helix protein 31
  • Hairy and enhancer of split-related protein 1
  • hairy/enhancer-of-split related with YRPW motif 1
  • hairy/enhancer-of-split related with YRPW motif protein 1
  • Hairy-related transcription factor 1
  • HERP2HES-related repressor protein 1
  • HESR-1
  • HESR1MGC1274
  • HES-related repressor protein 2
  • HRT1
  • HRT-1OAF1

Background

Hairy/enhancer of split-related proteins, such as HEY1, are basic helix-loop-helix (bHLH) transcription factors implicated in cell fate decision and boundary formation. HEY genes are direct transcriptional targets of the Notch signaling pathways in Drosophila and vertebrates. Hey1 functions as a corepressor, providing a mechanism of cross-talk between Notch and androgen signaling pathways. It is excluded from the nucleus in most human prostate cancers.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

HEY2 Antibody -
Azide and BSA Free
NBP3-03905
Western Blot HEY2 Antibody - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: WB
HES-1 Antibody
(OTI4H1)
NBP1-47791
Western Blot HES-1 Antibody (OTI4H1)
Immunocytochemistry/ Immunofluorescence HES-1 Antibody (OTI4H1)
Immunocytochemistry/ Immunofluorescence HES-1 Antibody (OTI4H1)
(8 Publications)
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
GATD3A Antibody
(1F5)
H00008209-M01
Immunocytochemistry/ Immunofluorescence GATD3A Antibody (1F5)
Immunohistochemistry-Paraffin GATD3A Antibody (1F5)
Sandwich ELISA GATD3A Antibody (1F5)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Notch-1 Antibody
(mN1A) - BSA Free
NB100-78486
Immunohistochemistry-Paraffin Notch-1 Antibody (mN1A) - BSA Free
Knockout Validated Notch-1 Antibody (mN1A) - BSA Free
Flow Cytometry Notch-1 Antibody (mN1A) - BSA Free
(2 Reviews)
(10 Publications)
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
csl/RBPJK Antibody
NBP1-33427
Chromatin Immunoprecipitation (ChIP) csl/RBPJK Antibody
Western Blot csl/RBPJK Antibody
Immunocytochemistry/ Immunofluorescence csl/RBPJK Antibody
(1 Review)
(1 Publication)
Species: Hu
Applications: ChIP, ICC/IF, WB
SLC6A3/DAT1
Antibody (mAb16)
NBP2-22164
Western Blot SLC6A3/DAT1 Antibody (mAb16)
Western Blot SLC6A3/DAT1 Antibody (mAb16)
Immunohistochemistry-Paraffin SLC6A3/DAT1 Antibody (mAb16)
(3 Reviews)
(14 Publications)
Species: Hu(-), Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Hey L Antibody
(1F6)
H00026508-M07
ELISA Hey L Antibody (1F6)
Immunocytochemistry/ Immunofluorescence Hey L Antibody (1F6)
Immunohistochemistry-Paraffin Hey L Antibody (1F6)
(1 Publication)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Notch-4 Antibody
[Unconjugated]
AF3847
Immunocytochemistry Notch-4 Antibody [Unconjugated]
(2 Publications)
Species: Hu
Applications: ICC, WB
RBX1 Antibody
(SR1116)
NBP3-21835
Western Blot RBX1 Antibody (SR1116)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IP, WB
Notch-2 Antibody
[Unconjugated]
AF3735
Immunohistochemistry Notch-2 Antibody [Unconjugated]
(6 Publications)
Species: Hu
Applications: IHC, WB
SCF/c-kit Ligand
[Unconjugated]
255-SC
SCF/c-kit Ligand [Unconjugated]
(195 Publications)
Species: Hu
Applications: BA
DLL4 Antibody
[Unconjugated]
AF1389
Western Blot DLL4 Antibody [Unconjugated]
Immunocytochemistry DLL4 Antibody [Unconjugated]
Immunohistochemistry DLL4 Antibody [Unconjugated]
(1 Review)
(63 Publications)
Species: Mu
Applications: ICC, IHC, WB
BMP-2
[Unconjugated]
355-BM
Bioactivity BMP-2 [Unconjugated]
(187 Publications)
Species: Hu, Mu, Rt
Applications: BA
Notch-3 Antibody
(1G5)
H00004854-M01
ELISA Notch-3 Antibody (1G5)
(1 Review)
(13 Publications)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Jagged 1
[Unconjugated]
1277-JG
Jagged 1 [Unconjugated]
(44 Publications)
Species: Hu
Applications: BA
HES5 Antibody -
BSA Free
NBP2-41305
Immunocytochemistry/ Immunofluorescence HES5 Antibody - BSA Free
Western Blot HES5 Antibody - BSA Free
Immunohistochemistry-Paraffin HES5 Antibody - BSA Free
(1 Publication)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
p21/CIP1/CDKN1A
Antibody (WA-1)
NBP2-29463
Immunohistochemistry-Paraffin p21/CIP1/CDKN1A Antibody (WA-1)
(24 Publications)
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
FBXW7/Cdc4 Antibody
NBP1-59631
Immunohistochemistry FBXW7/Cdc4 Antibody
Immunohistochemistry FBXW7/Cdc4 Antibody
Western Blot FBXW7/Cdc4 Antibody
(1 Review)
(4 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
VEGF [HRP]
DVE00
N/A VEGF [HRP]
N/A VEGF [HRP]
N/A VEGF [HRP]
(674 Publications)
Species: Hu
Applications: ELISA
HEY1 Recombinant
Protein Antigen
NBP2-56068PEP
HEY1 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for HEY1 Recombinant Protein Antigen (NBP2-56068PEP) (0)

There are no publications for HEY1 Recombinant Protein Antigen (NBP2-56068PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HEY1 Recombinant Protein Antigen (NBP2-56068PEP) (0)

There are no reviews for HEY1 Recombinant Protein Antigen (NBP2-56068PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for HEY1 Recombinant Protein Antigen (NBP2-56068PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HEY1 Products

Research Areas for HEY1 Recombinant Protein Antigen (NBP2-56068PEP)

Find related products by research area.

Blogs on HEY1

There are no specific blogs for HEY1, but you can read our latest blog posts.

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our HEY1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol HEY1