![Immunohistochemistry-Paraffin: GRHL3 Antibody [NBP2-57087] - Analysis in human urinary bladder and skeletal muscle tissues. Corresponding GRHL3 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/GRHL3-Antibody-Immunohistochemistry-Paraffin-NBP2-57087-img0005.jpg "Immunohistochemistry-Paraffin: GRHL3 Antibody [NBP2-57087] - Analysis in human urinary bladder and skeletal muscle tissues. Corresponding GRHL3 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VNGDDDSVAALSFLYDYYMGPKEKRILSSSTGGRNDQGKRYYHGMEYETDLTPLESPTHLMKFLTENVSGTPEYPDLLKKNNLMSL |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | GRHL3 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. IHC, Retrieval method: HIER pH6. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Immunohistochemistry EN-RAGE/S100A12 Antibody [Unconjugated]](https://images.novusbio.com/images2/EN-RAGE_AF1052_Immunohistochemistry_6671.jpg)
![Western Blot EN-RAGE/S100A12 Antibody [Unconjugated]](https://images.novusbio.com/images2/ENRAGE_AF1052_Western_Blot_19098.jpg)
![Simple Western EN-RAGE/S100A12 Antibody [Unconjugated]](https://images.novusbio.com/images2/af1052_human-en-rage-affinity-purified-polyclonal-ab-simple-western-2672021152820.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | GRHL3 |
![Immunocytochemistry/Immunofluorescence: GRHL3 Antibody [NBP2-57087] - Staining of human cell line MCF7 shows localization to nucleoplasm.](http://images.novusbio.com/fullsize/GRHL3-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-57087-img0001.jpg "Immunocytochemistry/Immunofluorescence: GRHL3 Antibody [NBP2-57087] - Staining of human cell line MCF7 shows localization to nucleoplasm.")
![Immunohistochemistry-Paraffin: GRHL3 Antibody [NBP2-57087] - Staining of human urinary bladder shows strong nuclear positivity in squamous epithelial cells.](http://images.novusbio.com/fullsize/GRHL3-Antibody-Immunohistochemistry-Paraffin-NBP2-57087-img0008.jpg "Immunohistochemistry-Paraffin: GRHL3 Antibody [NBP2-57087] - Staining of human urinary bladder shows strong nuclear positivity in squamous epithelial cells.")
![Immunohistochemistry-Paraffin: GRHL3 Antibody [NBP2-57087] - Staining of human skeletal muscle shows low expression as expected.](http://images.novusbio.com/fullsize/GRHL3-Antibody-Immunohistochemistry-Paraffin-NBP2-57087-img0002.jpg "Immunohistochemistry-Paraffin: GRHL3 Antibody [NBP2-57087] - Staining of human skeletal muscle shows low expression as expected.")
![Immunohistochemistry-Paraffin: GRHL3 Antibody [NBP2-57087] - Staining of human oral mucosa shows moderate nuclear positivity in squamous epithelial cells.](http://images.novusbio.com/fullsize/GRHL3-Antibody-Immunohistochemistry-Paraffin-NBP2-57087-img0006.jpg "Immunohistochemistry-Paraffin: GRHL3 Antibody [NBP2-57087] - Staining of human oral mucosa shows moderate nuclear positivity in squamous epithelial cells.")
![Immunohistochemistry-Paraffin: GRHL3 Antibody [NBP2-57087] - Staining of human skin shows moderate nuclear positivity in squamous epithelial cells.](http://images.novusbio.com/fullsize/GRHL3-Antibody-Immunohistochemistry-Paraffin-NBP2-57087-img0007.jpg "Immunohistochemistry-Paraffin: GRHL3 Antibody [NBP2-57087] - Staining of human skin shows moderate nuclear positivity in squamous epithelial cells.")
![Immunohistochemistry TFF2 Antibody (366508) [Unconjugated]](https://images.novusbio.com/images2/TFF2_MAB4077_Immunohistochemistry_21485.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")