Novus Biologicals products are now on bio-techne.com

C1q Recombinant Protein Antigen

Images

 
There are currently no images for C1q Protein (NBP1-87492PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

C1q Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human C1QA.

Source: E. coli

Amino Acid Sequence: GSPGNIKDQPRPAFSAIRRNPPMGGNVVIFDTVITNQEEPYQNHSGRFVCTVPGYYYFTFQVLSQWEICLSIVSSSRGQVRRSLGFCDTTNKGLFQVVSGGMVLQLQQGDQVWVEKDPKKGHIYQGSEADSVFS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
C1QA
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87492.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for C1q Recombinant Protein Antigen

  • A chain
  • complement component 1, q subcomponent, A chain
  • complement component 1, q subcomponent, alpha polypeptide

Background

C1q encodes a major constituent of the human complement subcomponent C1q. C1q associates with C1r and C1s in order to yield the first component of the serum complement system. Deficiency of C1q has been associated with lupus erythematosus and glomerulonephritis. C1q is composed of 18 polypeptide chains: six A-chains, six B-chains, and six C-chains. Each chain contains a collagen-like region located near the N terminus and a C-terminal globular region. The A-, B-, and C-chains are arranged in the order A-C-B on chromosome 1. This gene encodes the A-chain polypeptide of human complement subcomponent C1q.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87492
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-79788
Species: Hu
Applications: IHC, IHC-P, PA
NB200-540
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF3337
Species: Hu
Applications: ICC, WB
MAB10541
Species: Hu
Applications: CyTOF-ready, Flow, ICC, Neut
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
DY417
Species: Mu
Applications: ELISA
AF591
Species: Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC
NB100-314
Species: Hu
Applications: IP, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-36776
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
AF1936
Species: Hu
Applications: IP, WB
NBP3-12295
Species: Hu, Pm
Applications: ELISA, IHC, IHC-P, IP, WB
NBP2-34234
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P
6507-IL/CF
Species: Hu
Applications: BA
AF2558
Species: Hu, Mu
Applications: Simple Western, WB
DCDL40
Species: Hu
Applications: ELISA
NB100-56508
Species: Av, Hu, Mu, Rt
Applications: CyTOF-ready, Flow-CS, Flow, IHC, IHC-P, WB

Publications for C1q Protein (NBP1-87492PEP) (0)

There are no publications for C1q Protein (NBP1-87492PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for C1q Protein (NBP1-87492PEP) (0)

There are no reviews for C1q Protein (NBP1-87492PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for C1q Protein (NBP1-87492PEP). (Showing 1 - 1 of 1 FAQ).

  1. I am looking for polyclonal/monoclonal antibodies against canine C1q and complement-related. I was wondering if your prooduct does.
    • Please see the provided link below which will take you to our website and all of our C1Q antibodies that are available. Unfortunately we do not currently have an antibody that has been tested in dog but if that would be something you are interested in doing, I would like to invite you to review our Innovator's rewards program. Should you have any questions or concerns, please do not hesitate to contact me directly. C1Q antibodies: Innovators Rewards Program

Additional C1q Products

Research Areas for C1q Protein (NBP1-87492PEP)

Find related products by research area.

Blogs on C1q

There are no specific blogs for C1q, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our C1q Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol C1QA