Home » BAIAP2L1 » BAIAP2L1 Proteins » BAIAP2L1 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

BAIAP2L1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for BAIAP2L1 Protein (NBP1-89537PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

BAIAP2L1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human BAIAP2L1.

Source: E. coli

Amino Acid Sequence: LLSFAQGDVITLLIPEEKDGWLYGEHDVSKARGWFPSSYTKLLEENETEAVTVPTPSPTPVRSISTVNLSEN

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
BAIAP2L1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89537.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for BAIAP2L1 Recombinant Protein Antigen

  • BAI1-associated protein 2-like 1
  • BAI1-associated protein 2-like protein 1
  • brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 1
  • FLJ42275
  • IRTKSInsulin receptor tyrosine kinase substrate

Background

BAIAP2L1 (Brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 1) may function as an adapter protein. It contains an IRSp53/MIM homology domain (IMD) that bundles actin filaments, and interacts with the small GTPase Rac.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

BAIAP2 Antibody
NBP1-88711
Immunocytochemistry/ Immunofluorescence BAIAP2 Antibody
Immunohistochemistry-Paraffin BAIAP2 Antibody
Immunohistochemistry-Paraffin BAIAP2 Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MTSS1 Antibody
NBP2-24716
Immunohistochemistry-Paraffin MTSS1 Antibody
Western Blot MTSS1 Antibody
(2 Publications)
Species: Hu, Mu, Pm
Applications: ICC/IF, IHC, IHC-P, WB
N-WASP Antibody
NBP1-82512
Immunocytochemistry/ Immunofluorescence N-WASP Antibody
Immunohistochemistry-Paraffin N-WASP Antibody
Immunohistochemistry-Paraffin N-WASP Antibody
(7 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free
(3 Reviews)
(42 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Src [p Tyr419]
Antibody [Unconjugate
AF2685
Western Blot Src [p Tyr419] Antibody [Unconjugated]
Simple Western Src [p Tyr419] Antibody [Unconjugated]
Immunohistochemistry Src [p Tyr419] Antibody [Unconjugated]
(1 Review)
(10 Publications)
Species: Hu
Applications: IHC, Simple Western, WB
VASP Antibody
(OTI4D6)
NBP2-00555
Flow Cytometry VASP Antibody (OTI4D6)
Flow Cytometry VASP Antibody (OTI4D6)
Western Blot VASP Antibody (OTI4D6)
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
WASF2 Antibody
NBP2-37912
Immunocytochemistry/ Immunofluorescence WASF2 Antibody
Immunohistochemistry-Paraffin WASF2 Antibody
Immunohistochemistry-Paraffin WASF2 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Mena Antibody
NBP1-87914
Immunocytochemistry/ Immunofluorescence Mena Antibody
Western Blot Mena Antibody
Immunohistochemistry-Paraffin Mena Antibody
(5 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
ATN1 Antibody
NBP1-90044
Immunocytochemistry/ Immunofluorescence ATN1 Antibody
Immunohistochemistry-Paraffin ATN1 Antibody
Immunohistochemistry-Paraffin ATN1 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
CDC42 Antibody
(JJ086-04)
NBP2-67895
Flow Cytometry CDC42 Antibody (JJ086-04)
Immunohistochemistry-Paraffin CDC42 Antibody (JJ086-04)
Immunohistochemistry-Paraffin CDC42 Antibody (JJ086-04)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IP, WB
WASP Antibody
NB300-996
Immunohistochemistry-Paraffin WASP Antibody
Immunocytochemistry/ Immunofluorescence WASP Antibody
Immunocytochemistry/ Immunofluorescence WASP Antibody
(1 Publication)
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Neuropeptide Y
Antibody
NBP1-46535
Immunohistochemistry Neuropeptide Y Antibody
(20 Publications)
Species: Hu, Mu, Rb, Rt, Xp
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, WB
EGFR Antibody
[Unconjugated]
AF231
Immunohistochemistry EGFR Antibody [Unconjugated]
Immunocytochemistry EGFR Antibody [Unconjugated]
Western Blot EGFR Antibody [Unconjugated]
(30 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
NCK1 Antibody
(5B7) - BSA Free
NBP2-37490
ELISA NCK1 Antibody (5B7) - BSA Free
Western Blot NCK1 Antibody (5B7) - BSA Free
Western Blot NCK1 Antibody (5B7) - BSA Free
Species: Hu, Pm, Pm
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
PSD Antibody
H00005662-B01P
Western Blot PSD Antibody
Immunocytochemistry/ Immunofluorescence PSD Antibody
Western Blot PSD Antibody
Species: Hu, Rt
Applications: ICC/IF, WB
PISD Antibody
(OTI4G5)
NBP2-46421
Immunohistochemistry PISD Antibody (OTI4G5)
Immunohistochemistry PISD Antibody (OTI4G5)
Western Blot PISD Antibody (OTI4G5)
Species: Hu, Mu, Rt
Applications: IHC, WB
AKT [p Ser473]
Antibody [Unconjugate ...
AF887
Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
(49 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
BAIAP2L1
Recombinant Protein A
NBP1-89537PEP
BAIAP2L1 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for BAIAP2L1 Protein (NBP1-89537PEP) (0)

There are no publications for BAIAP2L1 Protein (NBP1-89537PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BAIAP2L1 Protein (NBP1-89537PEP) (0)

There are no reviews for BAIAP2L1 Protein (NBP1-89537PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for BAIAP2L1 Protein (NBP1-89537PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional BAIAP2L1 Products

Blogs on BAIAP2L1

There are no specific blogs for BAIAP2L1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Flow Cytometry: p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on HeLa cells with p53 (PAb240) NB200-103AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
p53 Antibody (PAb 240) - BSA Free
NB200-103

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our BAIAP2L1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol BAIAP2L1