![Immunohistochemistry-Paraffin: WASF2 Antibody [NBP2-37912] - Analysis in human esophagus and skeletal muscle tissues. Corresponding WASF2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/WASF2-Antibody-Immunohistochemistry-Paraffin-NBP2-37912-img0005.jpg "Immunohistochemistry-Paraffin: WASF2 Antibody [NBP2-37912] - Analysis in human esophagus and skeletal muscle tissues. Corresponding WASF2 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: DSASSPSPSFSEDNLPPPPAEFSYPVDNQRGSGLAGPKRSSVVSPSHPPPAP |
| Predicted Species | Mouse (92%), Rat (90%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | WASF2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
![Neutralization CXCL8/IL-8 Antibody (6217) [Unconjugated]](https://images.novusbio.com/images2/CXCL8_MAB208_Block_Neutralize_9064.jpg)
![Immunocytochemistry CXCL8/IL-8 Antibody (6217) [Unconjugated]](https://images.novusbio.com/images2/CXCL8_MAB208_Immunocytochemistry_9339.jpg)
![Western Blot CXCL8/IL-8 Antibody (6217) [Unconjugated]](https://images.novusbio.com/images2/mab208_human-il-8-cxcl8-mab-clone-6217-western-blot-1882021143847.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for WASF2 Antibody (NBP2-37912)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: WASF2 Antibody [NBP2-37912] - Staining of human cell line U-2 OS shows localization to plasma membrane. Antiibody staining is shown in green.](http://images.novusbio.com/fullsize/WASF2-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-37912-img0004.jpg "Immunocytochemistry/Immunofluorescence: WASF2 Antibody [NBP2-37912] - Staining of human cell line U-2 OS shows localization to plasma membrane. Antiibody staining is shown in green.")
![Immunohistochemistry-Paraffin: WASF2 Antibody [NBP2-37912] - Staining of human esophagus shows moderate cytoplasmic positivity in squamous epithelial cells.](http://images.novusbio.com/fullsize/WASF2-Antibody-Immunohistochemistry-Paraffin-NBP2-37912-img0011.jpg "Immunohistochemistry-Paraffin: WASF2 Antibody [NBP2-37912] - Staining of human esophagus shows moderate cytoplasmic positivity in squamous epithelial cells.")
![Immunohistochemistry-Paraffin: WASF2 Antibody [NBP2-37912] - Staining of human placenta shows strong cytoplasmic positivity in endothelial cells.](http://images.novusbio.com/fullsize/WASF2-Antibody-Immunohistochemistry-Paraffin-NBP2-37912-img0006.jpg "Immunohistochemistry-Paraffin: WASF2 Antibody [NBP2-37912] - Staining of human placenta shows strong cytoplasmic positivity in endothelial cells.")
![Immunohistochemistry-Paraffin: WASF2 Antibody [NBP2-37912] - Staining of human endometrium shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/WASF2-Antibody-Immunohistochemistry-Paraffin-NBP2-37912-img0007.jpg "Immunohistochemistry-Paraffin: WASF2 Antibody [NBP2-37912] - Staining of human endometrium shows strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: WASF2 Antibody [NBP2-37912] - Staining of human Fallopian tube shows moderate cytoplasmic positivity in glandular cells](http://images.novusbio.com/fullsize/WASF2-Antibody-Immunohistochemistry-Paraffin-NBP2-37912-img0008.jpg "Immunohistochemistry-Paraffin: WASF2 Antibody [NBP2-37912] - Staining of human Fallopian tube shows moderate cytoplasmic positivity in glandular cells")
![Immunohistochemistry-Paraffin: WASF2 Antibody [NBP2-37912] - Staining of human skeletal muscle shows low positivity in myocytes as expected.](http://images.novusbio.com/fullsize/WASF2-Antibody-Immunohistochemistry-Paraffin-NBP2-37912-img0009.jpg "Immunohistochemistry-Paraffin: WASF2 Antibody [NBP2-37912] - Staining of human skeletal muscle shows low positivity in myocytes as expected.")
![Western Blot Angiopoietin-like Protein 2/ANGPTL2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Angiopoietinlike_Protein_2_AF1444_Western_Blot_19840.jpg)
![Western Blot c-Abl Antibody [Unconjugated]](https://images.novusbio.com/images2/c-Abl_AF5414_Western_Blot_5714.jpg)
![Simple Western c-Abl Antibody [Unconjugated]](https://images.novusbio.com/images2/cAbl_AF5414_Simple_Western_17046.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")