Home » QARS » QARS Proteins » QARS Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

QARS Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for QARS Protein (NBP1-89487PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

QARS Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human QARS.

Source: E. coli

Amino Acid Sequence: HTGYVIELQHVVKGPSGCVESLEVTCRRADAGEKPKAFIHWVSQPLMCEVRLYERLFQHKNPEDPTEVPGGFLSDLNLASLHVVDA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
QARS1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89487.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.
Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for QARS Recombinant Protein Antigen

  • EC 6.1.1
  • EC 6.1.1.18
  • GLNRS
  • glutamine tRNA ligase
  • Glutamine--tRNA ligase
  • glutamine-tRNA synthetase
  • glutaminyl-tRNA synthetase
  • PRO2195

Background

Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. In metazoans, 9 aminoacyl-tRNA synthetases specific for glutamine (gln), glutamic acid (glu), and 7 other amino acids are associated within a multienzyme complex. Although present in eukaryotes, glutaminyl-tRNA synthetase (QARS) is absent from many prokaryotes, mitochondria, and chloroplasts, in which Gln-tRNA(Gln) is formed by transamidation of the misacylated Glu-tRNA(Gln). Glutaminyl-tRNA synthetase belongs to the class-I aminoacyl-tRNA synthetase family.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

EARS2 Antibody
NBP1-91856
Immunohistochemistry-Paraffin EARS2 Antibody
Immunocytochemistry/ Immunofluorescence EARS2 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
DARS Antibody
NBP1-85937
Immunohistochemistry-Paraffin DARS Antibody
Immunohistochemistry-Paraffin DARS Antibody
Immunohistochemistry-Paraffin DARS Antibody
(3 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, KD, WB
Glutamine
Synthetase Antibody
NB110-41404
Immunocytochemistry/ Immunofluorescence Glutamine Synthetase Antibody
Western Blot Glutamine Synthetase Antibody
Immunohistochemistry Glutamine Synthetase Antibody
(1 Review)
(11 Publications)
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NARS Antibody
NBP2-13640
Immunocytochemistry/ Immunofluorescence NARS Antibody
Immunohistochemistry-Paraffin NARS Antibody
Immunohistochemistry-Paraffin NARS Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Tryptophanyl tRNA
synthetase Antibody ( ...
NBP3-33363
Tryptophanyl tRNA synthetase Antibody (1C6K8)
Species: Hu
Applications: ELISA, IHC, IHC-P
WARS2 Antibody
NBP1-54653
Immunocytochemistry/ Immunofluorescence WARS2 Antibody
Immunocytochemistry/ Immunofluorescence WARS2 Antibody
Western Blot WARS2 Antibody
(1 Publication)
Species: Hu
Applications: WB
YARS Antibody
NBP1-86889
Immunocytochemistry/ Immunofluorescence YARS Antibody
Western Blot YARS Antibody
Immunohistochemistry-Paraffin YARS Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Tyrosinase
Antibody (JA52-11)
NBP2-67232
Immunocytochemistry/ Immunofluorescence Tyrosinase Antibody (JA52-11)
Immunocytochemistry/ Immunofluorescence Tyrosinase Antibody (JA52-11)
Immunohistochemistry-Paraffin Tyrosinase Antibody (JA52-11)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Glutaminyl-peptide
Cyclotransferase/QPCT ...
NBP1-81838
Western Blot Glutaminyl-peptide Cyclotransferase/QPCT Antibody
Immunohistochemistry Glutaminyl-peptide Cyclotransferase/QPCT Antibody
Immunohistochemistry-Paraffin Glutaminyl-peptide Cyclotransferase/QPCT Antibody
(1 Publication)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Methionyl tRNA
synthetase 2 Antibody
NBP1-92106
Immunohistochemistry-Paraffin Methionyl tRNA synthetase 2 Antibody
Immunocytochemistry/ Immunofluorescence Methionyl tRNA synthetase 2 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
DARS2 Antibody
NBP1-83854
Immunohistochemistry-Paraffin DARS2 Antibody
Western Blot DARS2 Antibody
Immunohistochemistry-Paraffin DARS2 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NARS2 Antibody
NBP1-82077
Immunocytochemistry/ Immunofluorescence NARS2 Antibody
Western Blot NARS2 Antibody
Immunohistochemistry-Paraffin NARS2 Antibody
(1 Review)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
YARS2 Antibody
NBP2-20928
Western Blot YARS2 Antibody
Immunohistochemistry-Paraffin YARS2 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
GLYAT Antibody
NBP2-58917
Western Blot GLYAT Antibody
Immunohistochemistry-Paraffin GLYAT Antibody
Immunohistochemistry-Paraffin GLYAT Antibody
Species: Hu
Applications: IHC, IHC-P, WB
CRAT Antibody
NBP1-86616
Western Blot CRAT Antibody
Western Blot CRAT Antibody
Immunohistochemistry-Paraffin CRAT Antibody
(2 Publications)
Species: Hu
Applications: IHC, IHC-P, WB
Catalase Antibody
[Unconjugated]
AF3398
Western Blot Catalase Antibody [Unconjugated]
Simple Western Catalase Antibody [Unconjugated]
Knockout Validated Catalase Antibody [Unconjugated]
(3 Reviews)
(15 Publications)
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
ArgRS Antibody
NBP2-31923
Immunohistochemistry ArgRS Antibody
Immunocytochemistry/ Immunofluorescence ArgRS Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
QARS Recombinant
Protein Antigen
NBP1-89487PEP
QARS Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for QARS Protein (NBP1-89487PEP) (0)

There are no publications for QARS Protein (NBP1-89487PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for QARS Protein (NBP1-89487PEP) (0)

There are no reviews for QARS Protein (NBP1-89487PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for QARS Protein (NBP1-89487PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional QARS Products

Blogs on QARS

There are no specific blogs for QARS, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Western blot shows lysates of Jurkat human acute T cell leukemia cell line, Raji human Burkitt's lymphoma cell line, HeLa human cervical epithelial carcinoma cell line, NIH-3T3 mouse embryonic fibroblast cell line, A20 mouse B cell lymphoma cell line, and Rat-2 rat embryonic fibroblast cell line. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse/Rat Catalase Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3398) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for Catalase at approximately 64 kDa (as indicated). This experiment was conducted using Immunoblot Buffer Group 2.
Catalase Antibody [Unconjugated]
AF3398
Immunocytochemistry/Immunofluorescence: Glutamine Synthetase Antibody [NB110-41404] - Immunofluorescence using NB110-41404. Submitted via verified customer review.
Glutamine Synthetase Antibody
NB110-41404

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our QARS Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol QARS1