![Immunohistochemistry-Paraffin: WDR35 Antibody [NBP1-92581] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/WDR35-Antibody-Immunohistochemistry-Paraffin-NBP1-92581-img0006.jpg "Immunohistochemistry-Paraffin: WDR35 Antibody [NBP1-92581] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SLPNVGLIQKYSLNCRAYQLSLNCNSSRLAIIDISGVLTFFDLDARVTDSTGQQVVGELLKLERRDVWDMKWAKDNPDLFAMMEKTRMYVFRNLDPEEPIQTSGY |
| Predicted Species | Mouse (93%), Rat (93%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | WDR35 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for WDR35 Antibody (NBP1-92581)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | WDR35 |
![Immunohistochemistry-Paraffin: WDR35 Antibody [NBP1-92581] - Staining of human hippocampus shows strong cytoplasmic positivity in neurons.](http://images.novusbio.com/fullsize/WDR35-Antibody-Immunohistochemistry-Paraffin-NBP1-92581-img0002.jpg "Immunohistochemistry-Paraffin: WDR35 Antibody [NBP1-92581] - Staining of human hippocampus shows strong cytoplasmic positivity in neurons.")
![Immunohistochemistry-Paraffin: WDR35 Antibody [NBP1-92581] - Staining of human cerebral cortex shows moderate granular cytoplasmic positivity in neurons.](http://images.novusbio.com/fullsize/WDR35-Antibody-Immunohistochemistry-Paraffin-NBP1-92581-img0003.jpg "Immunohistochemistry-Paraffin: WDR35 Antibody [NBP1-92581] - Staining of human cerebral cortex shows moderate granular cytoplasmic positivity in neurons.")
![Immunohistochemistry-Paraffin: WDR35 Antibody [NBP1-92581] - Staining of human Fallopian tube shows moderate cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/WDR35-Antibody-Immunohistochemistry-Paraffin-NBP1-92581-img0004.jpg "Immunohistochemistry-Paraffin: WDR35 Antibody [NBP1-92581] - Staining of human Fallopian tube shows moderate cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: WDR35 Antibody [NBP1-92581] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/WDR35-Antibody-Immunohistochemistry-Paraffin-NBP1-92581-img0005.jpg "Immunohistochemistry-Paraffin: WDR35 Antibody [NBP1-92581] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_6532.jpg)
![Immunohistochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase3_AF835_Immunohistochemistry_22976.jpg)
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_9340.jpg)
![Western Blot ST8 alpha-2,8-Sialyltransferase 8B/ST8SIA2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ST8SIA2_AF6590_Western_Blot_11615.jpg)
![Immunohistochemistry ST8 alpha-2,8-Sialyltransferase 8B/ST8SIA2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ST8SIA2_AF6590_Immunohistochemistry_11705.jpg)
![Intracellular Staining by Flow Cytometry ST8 alpha-2,8-Sialyltransferase 8B/ST8SIA2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ST8SIA2_AF6590_Flow_Cytometry_11747.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_871.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_872.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/VEGF_DVE00_ELISA_208.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")