![Western Blot: ULK3 Antibody [NBP2-13505] - Lane 1: Mouse liver tissue lysate Lane 2: Rat liver tissue lysate](http://images.novusbio.com/fullsize/ULK3-Antibody-Western-Blot-NBP2-13505-img0004.jpg "Western Blot: ULK3 Antibody [NBP2-13505] - Lane 1: Mouse liver tissue lysate Lane 2: Rat liver tissue lysate")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the amino acids: ILKGIRHPHIVQLKDFQWDSDNIYLIMEFCAGGDLSRFIHTRRILPEKVARVFMQQLASALQFLHERNISHLDLKPQNILLSSLEKPHLKLADFGFAQHMSPWDEKHVLRGSPLYMAPEMVCQRQYDARVDLWSMGVILYGETSFPC |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ULK3 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot LMAN1L/SLAMP Antibody [Unconjugated]](https://images.novusbio.com/images2/LMAN1L_AF6017_Western_Blot_9508.jpg)
![Western Blot p70 S6 Kinase/S6K Antibody [Unconjugated]](https://images.novusbio.com/images2/p70_S6_Kinase_AF8962_Western_Blot_5937.jpg)
![Simple Western p70 S6 Kinase/S6K Antibody [Unconjugated]](https://images.novusbio.com/images2/16345.jpg)
![Immunohistochemistry p70 S6 Kinase/S6K Antibody [Unconjugated]](https://images.novusbio.com/images2/p70_S6_Kinase_AF8962_Immunohistochemistry_7347.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for ULK3 Antibody (NBP2-13505)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ULK3 |
![Immunohistochemistry-Paraffin: ULK3 Antibody [NBP2-13505] - Staining of human colon shows distinct cytoplasmic positivity with a granular pattern in glandular cells.](http://images.novusbio.com/fullsize/ULK3-Antibody-Immunohistochemistry-Paraffin-NBP2-13505-img0001.jpg "Immunohistochemistry-Paraffin: ULK3 Antibody [NBP2-13505] - Staining of human colon shows distinct cytoplasmic positivity with a granular pattern in glandular cells.")
![Western Blot: ULK3 Antibody [NBP2-13505] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue](http://images.novusbio.com/fullsize/ULK3-Antibody-Western-Blot-NBP2-13505-img0003.jpg "Western Blot: ULK3 Antibody [NBP2-13505] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue")
![Bioactivity Sonic Hedgehog/Shh [Unconjugated]](https://images.novusbio.com/images2/Sonic_Hedgehog_464SH_2840.jpg)
![SDS-PAGE Sonic Hedgehog/Shh [Unconjugated]](https://images.novusbio.com/images2/Sonic_Hedgehog_464-SH_341.jpg)
![SEC-MALS Sonic Hedgehog/Shh [Unconjugated]](https://images.novusbio.com/images/464-sh_recombinant-mouse-sonic-hedgehog-shh-c25ii-n-terminus-sec-mals-642023224324.jpg)
![Immunohistochemistry-Paraffin TOR/mTOR [p Ser2448] Antibody](https://images.novusbio.com/images/TOR-mTOR-[p-Ser2448]-Antibody-Immunohistochemistry-Paraffin-NB600-607-img0005.jpg)
![Western Blot TOR/mTOR [p Ser2448] Antibody](https://images.novusbio.com/images/TOR-mTOR-[p-Ser2448]-Antibody-Western-Blot-NB600-607-img0006.jpg)
![Data TOR/mTOR [p Ser2448] Antibody](https://images.novusbio.com/images/TOR-mTOR-[p-Ser2448]-Antibody-N-A-NB600-607-img0008.jpg)
![Western Blot eIF4E [p Ser209] Antibody](https://images.novusbio.com/images/eIF4E-[p-Ser209]-Antibody-Western-Blot-NB100-81898-img0009.jpg)
![Immunocytochemistry/ Immunofluorescence eIF4E [p Ser209] Antibody](https://images.novusbio.com/images/eIF4E-[p-Ser209]-Antibody-Immunocytochemistry-Immunofluorescence-NB100-81898-img0005.jpg)
![Immunohistochemistry-Paraffin eIF4E [p Ser209] Antibody](https://images.novusbio.com/images/eIF4E-[p-Ser209]-Antibody-Immunohistochemistry-NB100-81898-img0006.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")