| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, MA, AP |
| Description | A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 361-470 of Human UBE2O Source: Wheat Germ (in vitro) Amino Acid Sequence: VEPAKIAWECPEKNCAQGEGSMAKKVKRLLKKQVVRIMSCSPDTQCSRDHSMEDPDKKGESKTKSEAESASPEETPDGSASPVEMQDEGAEEPHEAGEQLPPFLLKEGRD |
| Preparation Method |
in vitro wheat germ expression system |
| Details of Functionality | This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated. |
| Source | Wheat germ |
| Protein/Peptide Type | Partial Recombinant Protein |
| Gene | UBE2O |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
| Dilutions |
|
| Theoretical MW | 37.84 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -80C. Avoid freeze-thaw cycles. |
| Buffer | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
| Preservative | No Preservative |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
Research Areas for UBE2O Partial Recombinant Protein (H00063893-Q01)Find related products by research area.
|
|
Muscle-specific UBE2O ablation requires activated AMPK alpha 2 to protect against metabolic syndrome By Jamshed Arslan, Pharm. D., PhD. Generating energy (ATP) from nutrients is a recipe for life. One of the sensors of cellular energy levels is the serine/threonine kinase AMPK. This enzyme facilitates lipid oxidati... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | UBE2O |
![Western Blot Butyrylcholinesterase/BCHE Antibody [Unconjugated]](https://images.novusbio.com/images2/Butyrylcholinesterase_AF9024_Western_Blot_19121.jpg)
![Immunohistochemistry Butyrylcholinesterase/BCHE Antibody [Unconjugated]](https://images.novusbio.com/images2/Butyrylcholinesterase_AF9024_Immunohistochemistry_19158.jpg)