Novus Biologicals products are now on bio-techne.com

Tyrosine Hydroxylase Antibody (CL3049)

Images

 
Immunohistochemistry: Tyrosine Hydroxylase Antibody (CL3049) [NBP2-46647] - Staining of mouse brain shows strong positivity in neurons in the hypothalamus.
Immunohistochemistry: Tyrosine Hydroxylase Antibody (3049) [NBP2-46647] - Staining of human caudate nucleus shows immunoreactivity in monoaminergic neural fibers.
Immunohistochemistry: Tyrosine Hydroxylase Antibody (3049) [NBP2-46647] - Staining of human prostate shows strong immunoreactivity in sympathetic fibers.
Immunohistochemistry: Tyrosine Hydroxylase Antibody (3049) [NBP2-46647] - Analysis of human kidney shows absence of immunoreactivity (negative control).
Immunohistochemistry: Tyrosine Hydroxylase Antibody (3049) [NBP2-46647] - Immunohistochemical staining of rat locus coeruleus using Tyrosine Hydroxylase antibody (clone 3049) with immunofluorescence based detection ...read more
Immunohistochemistry: Tyrosine Hydroxylase Antibody (CL3049) [NBP2-46647] - Staining of rat locus coeruleus shows strong positivity in noradrenergic neurons.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC
Clone
CL3049
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Tyrosine Hydroxylase Antibody (CL3049) Summary

Immunogen
This Tyrosine Hydroxylase Antibody (CL3049) is made against a recombinant protein epitope signature tag (PrEST) antigen sequence corresponding to AA465-528 of human tyrosine hydroxylase (UniProtKB - P07101): SESFSDAKDKLRSYASRIQRPFSVKFDPYTLAIDVLDSPQAVRRSLEGVQDELDTLAHALSAIG
Isotype
IgG1
Clonality
Monoclonal
Host
Mouse
Gene
TH
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Theoretical MW
60 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
Tyrosine Hydroxylase Recombinant Protein Antigen (NBP2-46647PEP)
Publications
Read Publication using
NBP2-46647 in the following applications:

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Mouse-On-Mouse blocking reagent may be needed for IHC and ICC experiments to reduce high background signal. You can find these reagents under catalog numbers PK-2200-NB and MP-2400-NB. Please contact Technical Support if you have any questions

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2), 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for Tyrosine Hydroxylase Antibody (CL3049)

  • DYT14
  • DYT5b
  • EC 1.14.16
  • EC 1.14.16.2
  • TH
  • TYH dystonia 14
  • TYH
  • Tyrosine 3-hydroxylase
  • tyrosine 3-monooxygenase
  • Tyrosine Hydroxylase

Background

The tetrameric enzyme tyrosine hydroxylase (TH), also designated as tyrosine 3-monooxygenase (TY3H), is the rate-limiting enzyme for catecholamine biosynthesis and has a theoretical molecular weight of 60 kDa. Encoded by the TH gene, TH catalyzes the conversion of the amino acid L-tyrosine to L-3,4- dihydroxyphenylalanine (L-dopa) in the central nervous system and adrenal medulla. The precursor of catecholamines, L-dopa, is converted to dopamine for use in the biosynthesis of neurotransmitters norepinephrine (noradrenaline) and epinephrine (adrenaline) (1) . Dysfunction in the TH gene, and thus the enzymatic activity by TH, dysregulates catecholamine synthesis.

Two transcription factor binding sites in the proximal region of the TH gene, the TPA-responsive element (TRE) and the c-AMP responsive element (CRE), have been implicated in the complex regulation of the TH gene. Dysregulation of breakdown for the amino acid, tyrosine, by TH is a result of a genetic disorder that results in Tyrosinemia (high levels of tyrosine in the blood, tissue and organs).

Tyrosine hydroxylase deficiency is a disorder that primarily affects movement, where individuals display symptoms that include lack of coordination when walking, postural tremors and unusual body positioning. TH deficient dopamine-responsive dystonia (DRD), also known as Segawa syndrome, is a rare genetic disorder that is associated with low levels of TH and is diagnosed during childhood with characteristic symptoms including increased muscle tone (dystonia) and signs of Parkinsonism like bradykinesia, tremors, rigidity and postural instability (2). Correspondingly, TH is also linked to Parkinson's disease in older adults, where low dopamine levels are a consistent neurochemical abnormality. Functional polymorphisms of the TH gene may be involved in the pathogenesis of neuropsychiatric diseases such as schizophrenia and other affective disorders where dopamine is often dysregulated (3).

References

1. Hamanaka, Y., & Mizunami, M. (2019). Tyrosine hydroxylase-immunoreactive neurons in the mushroom body of the field cricket, Gryllus bimaculatus. Cell Tissue Res, 376(1), 97-111. doi:10.1007/s00441-018-2969-9

2. Li, L., & Zhou, F. M. (2013). Parallel dopamine D1 receptor activity dependence of l-Dopa-induced normal movement and dyskinesia in mice. Neuroscience, 236, 66-76. doi:10.1016/j.neuroscience.2012.12.065

3. Borkar, C. D., Bharne, A. P., Nagalakshmi, B., Sakharkar, A. J., Subhedar, N. K., & Kokare, D. M. (2018). Cocaine- and Amphetamine-Regulated Transcript Peptide (CART) Alleviates MK-801-Induced Schizophrenic Dementia-Like Symptoms. Neuroscience, 375, 94-107. doi:10.1016/j.neuroscience.2018.01.056

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31386
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-46535
Species: Hu, Mu, Rb, Rt, Xp
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, WB
NBP2-00688
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-30052
Species: Ch, Gp, Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, WB
NBP2-46349
Species: Hu
Applications: IHC, WB
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
212-GD
Species: Hu
Applications: Bind, BA
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
NBP2-27202
Species: Ca, Ch, ChHa, Fe, Hu, Mu, Ma-Op, Po, Pm, Rt
Applications: ICC/IF, Simple Western, WB
NBP2-15895
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB600-534
Species: Hu, Mu, Po, V-Vi
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, In vivo, RIA, WB
DBD00
Species: Hu
Applications: ELISA
NBP2-22164
Species: Hu(-), Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NB300-141
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
AF1445
Species: Mu, Rt
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, Simple Western, WB
NB110-41404
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NB100-1519
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-FrFl, PEP-ELISA, WB

Publications for Tyrosine Hydroxylase Antibody (NBP2-46647)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: IHC-Fr.


Filter By Application
IHC-Fr
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for Tyrosine Hydroxylase Antibody (NBP2-46647) (0)

There are no reviews for Tyrosine Hydroxylase Antibody (NBP2-46647). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Tyrosine Hydroxylase Antibody (NBP2-46647) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Tyrosine Hydroxylase Products

Research Areas for Tyrosine Hydroxylase Antibody (NBP2-46647)

Find related products by research area.

Blogs on Tyrosine Hydroxylase.

Successful Transplantation of Friedreich Ataxia Induced Pluripotent Stem Cell (iPSC)-Derived Sensory Neurons in Dorsal Root Ganglia of Adult Rodents
Jamshed Arslan, Pharm D, PhD The dorsal root ganglia (DRG) are a collection of cell bodies of sensory nerves carrying sensory information – including nociception, mechanoreception and proprioception – from periphera...  Read full blog post.

The identification of dopaminergic neurons using Tyrosine Hydroxylase in Parkinson's research and LRRK2
Tyrosine hydroxylase (TH) is a crucial enzyme involved in the biosynthesis of dopamine, norepinephrine and epinephrine in the brain.  Specifically, TH catalyzes the conversion of l-tyrosine to l-dihydroxyphenylalanine (l-dopa).  The importance of t...  Read full blog post.

Tyrosine hydroxylase - a marker for dopaminergic neurons in the central nervous system
Tyrosine hydroxylase is a member of the aromatic amino acid hydroxylase (AAAH) family.  It is expressed throughout the central nervous system (CNS) and catalyzes the conversion of tyrosine to L-3,4-dihydroxyphenylalanine (L-DOPA), which can be, thr...  Read full blog post.

Tyrosine Hydroxylase - rate-limiting enzyme in catecholamine synthesis
Catecholamines are tyrosine-derived hormones that are produced in the adrenal gland. They include epinephrine, norepinephrine, and dopamine and are used as neurotransmitters by the central and peripheral nervous system. The rate limiting enzyme in ...  Read full blog post.

A Big Guy for the Catecholamine Synthesis - Tyrosine hydroxylase (TH)
In the synthesis pathway for the catecholamines - dopamine, epinephrine, and norepinephrine, tyrosine hydroxylase is the rate-limiting enzyme. Through alternative mRNA splicing, a wide molecular diversity of TH isoforms are generated that are tissue-s...  Read full blog post.

Tyrosine Hydroxylase Deficiencies and Neurodegeneration
Tyrosine hydroxylase is the rate-limiting enzyme in the synthesis pathway of the catecholamines dopamine, epinephrine, and norepinephrine. Alternative mRNA splicing generates a wide molecular diversity of TH isoforms that are tissue specific and produ...  Read full blog post.

Tyrosine Hydroxylase Deficiency and Brain Disorders
 Tyrosine hydroxylase catalyzes the rate-limiting step in the biosynthesis of the catecholamines dopamine, norepinephrine, and epinephrine. A hallmark of Parkinson's disease is the loss of dopaminergic neurons in the substantia nigra. Mutations in cas...  Read full blog post.

mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Tyrosine Hydroxylase Antibody (CL3049) and receive a gift card or discount.

Bioinformatics

Gene Symbol TH
Entrez
Uniprot