Home » Tryptophanyl tRNA synthetase » Tryptophanyl tRNA synthetase Proteins » Tryptophanyl tRNA synthetase Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Tryptophanyl tRNA synthetase Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Tryptophanyl tRNA synthetase Recombinant Protein Antigen (NBP2-55377PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Tryptophanyl tRNA synthetase Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to Tryptophanyl tRNA synthetase.

Source: E. coli

Amino Acid Sequence: TDSDCIGKISFPAIQAAPSFSNSFPQIFRDRTDIQCLIPCAIDQDPYFRMTRDVAPRIGYPKPALLHSTFFPALQGAQTKMSASDPNSSIFLTDTAKQIKTKVNKHAFSGGRDTIEEHRQFGGNCDVDVSFMYLTF

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
WARS1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55377.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.
Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Tryptophanyl tRNA synthetase Recombinant Protein Antigen

  • EC 6.1.1
  • EC 6.1.1.2
  • GAMMA-2
  • hWRS
  • IFI53
  • IFP53trpRS
  • Interferon-induced protein 53
  • TrpRS
  • tryptophan tRNA ligase 1, cytoplasmic
  • Tryptophan--tRNA ligase
  • tryptophanyl-tRNA synthetase
  • tryptophanyl-tRNA synthetase, cytoplasmic
  • WRS

Background

Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Two forms of tryptophanyl-tRNA synthetase exist, a cytoplasmic form, named WARS, and a mitochondrial form, named WARS2. Tryptophanyl-tRNA synthetase (WARS) catalyzes the aminoacylation of tRNA(trp) with tryptophan and is induced by interferon. Tryptophanyl-tRNA synthetase belongs to the class I tRNA synthetase family. Four transcript variants encoding two different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

WARS2 Antibody
NBP1-54653
Immunocytochemistry/ Immunofluorescence WARS2 Antibody
Immunocytochemistry/ Immunofluorescence WARS2 Antibody
Western Blot WARS2 Antibody
(1 Publication)
Species: Hu
Applications: WB
TYRP1 Antibody
NBP1-88370
Western Blot TYRP1 Antibody
Immunohistochemistry-Paraffin TYRP1 Antibody
Immunohistochemistry-Paraffin TYRP1 Antibody
(4 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
TBP like protein
TLP Antibody
NBP2-49671
Immunohistochemistry-Paraffin TBP like protein TLP Antibody
Immunohistochemistry-Paraffin TBP like protein TLP Antibody
Immunohistochemistry-Paraffin TBP like protein TLP Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
YARS Antibody
NBP1-86889
Immunocytochemistry/ Immunofluorescence YARS Antibody
Western Blot YARS Antibody
Immunohistochemistry-Paraffin YARS Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
IFN-gamma
[Unconjugated]
285-IF
Bioactivity IFN-gamma [Unconjugated]
SDS-PAGE IFN-gamma [Unconjugated]
SEC-MALS IFN-gamma [Unconjugated]
(2 Reviews)
(450 Publications)
Species: Hu
Applications: BA
YARS2 Antibody
NBP2-20928
Western Blot YARS2 Antibody
Immunohistochemistry-Paraffin YARS2 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
KLF6 Antibody
AF3499
KLF6 Antibody
(4 Publications)
Species: Hu
Applications: WB
Glutaminyl-peptide
Cyclotransferase/QPCT ...
NBP1-81838
Western Blot Glutaminyl-peptide Cyclotransferase/QPCT Antibody
Immunohistochemistry Glutaminyl-peptide Cyclotransferase/QPCT Antibody
Immunohistochemistry-Paraffin Glutaminyl-peptide Cyclotransferase/QPCT Antibody
(1 Publication)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
EGF [Unconjugated]
236-EG
SDS-PAGE EGF [Unconjugated]
Bioactivity EGF [Unconjugated]
Cell Culture EGF [Unconjugated]
(825 Publications)
Species: Hu
Applications: BA
Gastrin Antibody
NBP3-12223
Immunohistochemistry-Paraffin Gastrin Antibody
Unknown Gastrin Antibody
Species: Hu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(810 Publications)
Species: Hu
Applications: BA
Catalase Antibody
[Unconjugated]
AF3398
Western Blot Catalase Antibody [Unconjugated]
Simple Western Catalase Antibody [Unconjugated]
Knockout Validated Catalase Antibody [Unconjugated]
(3 Reviews)
(15 Publications)
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
IFN-alpha 1
Antibody
NBP2-75930
Western Blot IFN-alpha 1 Antibody
Immunocytochemistry/ Immunofluorescence IFN-alpha 1 Antibody
Immunocytochemistry/ Immunofluorescence IFN-alpha 1 Antibody
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
COX-2 Antibody
NB100-689
Immunohistochemistry-Paraffin COX-2 Antibody
Simple Western COX-2 Antibody
(1 Review)
(36 Publications)
Species: Hu, Rt
Applications: IHC, IHC-Fr, IHC-P, Simple Western, WB
QARS Antibody
NBP1-89487
Immunocytochemistry/ Immunofluorescence QARS Antibody
Immunohistochemistry-Paraffin QARS Antibody
Western Blot QARS Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
GLYAT Antibody
NBP2-58917
Western Blot GLYAT Antibody
Immunohistochemistry-Paraffin GLYAT Antibody
Immunohistochemistry-Paraffin GLYAT Antibody
Species: Hu
Applications: IHC, IHC-P, WB
CRAT Antibody
NBP1-86616
Western Blot CRAT Antibody
Western Blot CRAT Antibody
Immunohistochemistry-Paraffin CRAT Antibody
(2 Publications)
Species: Hu
Applications: IHC, IHC-P, WB
SOD1/Cu-Zn SOD
Antibody
NBP2-24915
Western Blot SOD1/Cu-Zn SOD Antibody
Western Blot SOD1/Cu-Zn SOD Antibody
Immunohistochemistry-Paraffin SOD1/Cu-Zn SOD Antibody
(3 Reviews)
(20 Publications)
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
iNOS Antibody -
BSA Free
NB300-605
Western Blot iNOS Antibody - BSA Free
Western Blot iNOS Antibody - BSA Free
Western Blot iNOS Antibody - BSA Free
(3 Reviews)
(130 Publications)
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, WB
Indoleamine
2,3-dioxygenase/IDO A ...
NBP1-87702
Western Blot Indoleamine 2,3-dioxygenase/IDO Antibody
Immunohistochemistry-Paraffin Indoleamine 2,3-dioxygenase/IDO Antibody
Immunohistochemistry-Paraffin Indoleamine 2,3-dioxygenase/IDO Antibody
(5 Publications)
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB

Publications for Tryptophanyl tRNA synthetase Recombinant Protein Antigen (NBP2-55377PEP) (0)

There are no publications for Tryptophanyl tRNA synthetase Recombinant Protein Antigen (NBP2-55377PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Tryptophanyl tRNA synthetase Recombinant Protein Antigen (NBP2-55377PEP) (0)

There are no reviews for Tryptophanyl tRNA synthetase Recombinant Protein Antigen (NBP2-55377PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Tryptophanyl tRNA synthetase Recombinant Protein Antigen (NBP2-55377PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Tryptophanyl tRNA synthetase Products

Research Areas for Tryptophanyl tRNA synthetase Recombinant Protein Antigen (NBP2-55377PEP)

Find related products by research area.

Blogs on Tryptophanyl tRNA synthetase

There are no specific blogs for Tryptophanyl tRNA synthetase, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Tryptophanyl tRNA synthetase Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol WARS1