![Western Blot: TRUB1 Antibody [NBP1-80866] - Analysis in control (vector only transfected HEK293T lysate) and TRUB1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/TRUB1-Antibody-Western-Blot-NBP1-80866-img0008.jpg "Western Blot: TRUB1 Antibody [NBP1-80866] - Analysis in control (vector only transfected HEK293T lysate) and TRUB1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TDTLDSTGRVTEEKPYDKITQEDIEGILQKFTGNIMQVPPLYSALKKDGQRLSTLMKRGEVVEAKPARPVTVYSISLQKFQPPFFTLDVECGGG |
| Predicted Species | Mouse (93%), Rat (94%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TRUB1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publications using NBP1-80866 | Applications | Species |
|---|---|---|
| Park S, Dahn R, Kurt E et al. The midbody and midbody remnant are assembly sites for RNA and active translation Research Square 2022-11-23 (ICC/IF, Human, Hamster) | ICC/IF | Human, Hamster |
| Wong, CP, CP Effect of Peroxisome Proliferation on Replication of Emerging RNA Viruses Thesis 2022-01-01 (ICC/IF, Monkey, Human) | ICC/IF | Monkey, Human |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: TRUB1 Antibody [NBP1-80866] - Staining of human cell line U-2 OS shows localization to actin filaments. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/TRUB1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-80866-img0006.jpg "Immunocytochemistry/Immunofluorescence: TRUB1 Antibody [NBP1-80866] - Staining of human cell line U-2 OS shows localization to actin filaments. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: TRUB1 Antibody [NBP1-80866] - Staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/TRUB1-Antibody-Immunohistochemistry-Paraffin-NBP1-80866-img0011.jpg "Immunohistochemistry-Paraffin: TRUB1 Antibody [NBP1-80866] - Staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: TRUB1 Antibody [NBP1-80866] - Staining of human testis shows moderate cytoplasmic positivity in a subset of cells in seminiferous ducts.](http://images.novusbio.com/fullsize/TRUB1-Antibody-Immunohistochemistry-Paraffin-NBP1-80866-img0009.jpg "Immunohistochemistry-Paraffin: TRUB1 Antibody [NBP1-80866] - Staining of human testis shows moderate cytoplasmic positivity in a subset of cells in seminiferous ducts.")
![Immunohistochemistry-Paraffin: TRUB1 Antibody [NBP1-80866] - Staining of human endometrium shows moderate cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/TRUB1-Antibody-Immunohistochemistry-Paraffin-NBP1-80866-img0010.jpg "Immunohistochemistry-Paraffin: TRUB1 Antibody [NBP1-80866] - Staining of human endometrium shows moderate cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: TRUB1 Antibody [NBP1-80866] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.](http://images.novusbio.com/fullsize/TRUB1-Antibody-Immunohistochemistry-Paraffin-NBP1-80866-img0012.jpg "Immunohistochemistry-Paraffin: TRUB1 Antibody [NBP1-80866] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.")
![Western Blot GCN2 [p Thr899] Antibody](https://images.novusbio.com/images2/GCN2_AF7605_Western_Blot_12440.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")