Do you produce an enzymatically active human or murine steroid sulfatase? Is H00000412-Q01 enzymatically active?

Name: Recombinant Human Steroid sulfatase GST (N-Term) Protein
Brand: Novus Biologicals
SKU: H00000412-Q01
Price: 569 USD

Question

Accepted Answer

This product is produced by a Taiwanese company called Abnova and we distribute it for them. They do not test the activity of their recombinant proteins. The proteins are produced in a cell-free wheat germ system with an N-terminal 26kDa GST-tag. Due to this expression system, in our experience, the proteins do not always undergo the same folding and post-transnational modifications they might undergo in an endogenous cell. Because of this, we do not recommend this protein for use in functional assays and do not guarantee them for this use. They are mainly intended for use in Western Blots as a positive control with their antibody. We carry a number of other sulfatase proteins including iduronate 2 sulfatase, sulfatase 1 and sulfatase 2. Most are Abnova proteins and are not predicted to be enzymatically active

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

Description	A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 248-350 of Human Steroid sulfatase Source: Wheat Germ (in vitro) Amino Acid Sequence: YEIIQQPMSYDNLTQRLTVEAAQFIQRNTETPFLLVLSYLHVHTALFSSKDFAGKSQHGVYGDAVEEMDWSVGQILNLLDELRLANDTLIYFTSDQGAHVEEV
Preparation Method	in vitro wheat germ expression system
Details of Functionality	This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source	Wheat germ
Protein/Peptide Type	Partial Recombinant Protein
Gene	STS
Purity	>80% by SDS-PAGE and Coomassie blue staining

Dilutions	ELISA Immunoaffinity Purification Protein Array Western Blot
Theoretical MW	37.07 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Storage	Store at -80C. Avoid freeze-thaw cycles.
Buffer	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Recombinant Human Steroid sulfatase GST (N-Term) Protein

Species Glossary

Images

Product Details

Order Details

Recombinant Human Steroid sulfatase GST (N-Term) Protein Summary

Applications/Dilutions

Packaging, Storage & Formulations

Notes

Alternate Names for Recombinant Human Steroid sulfatase GST (N-Term) Protein

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for Steroid sulfatase Partial Recombinant Protein (H00000412-Q01) (0)

Reviews for Steroid sulfatase Partial Recombinant Protein (H00000412-Q01) (0)

Product General Protocols

Video Protocols

FAQs for Steroid sulfatase Partial Recombinant Protein (H00000412-Q01). (Showing 1 - 1 of 1 FAQ).

Additional Steroid sulfatase Products

Research Areas for Steroid sulfatase Partial Recombinant Protein (H00000412-Q01)

Blogs on Steroid sulfatase

Contact Information

Product PDFs

Calculators

Review this Product

Bioinformatics