SPRY4 Antibody Summary
Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LEACFSVQSRTSSPMEPPIPQSAPLTPNSVMVQPLLDSRMSHSRLQHPLT |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
SPRY4 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Western Blot 0.04-0.4 ug/ml
|
Application Notes |
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
Control Peptide |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for SPRY4 Antibody
Background
Sprouty-4 (also known as SPRY4) is an inhibitor of the insulin receptor and EGFR-transduced mitogen-activated protein kinase (MAPK) signaling pathway downstream of FGF and EGF receptor tyrosine kinase activation. It is positioned upstream of RAS activation and impairs the formation of active GTP-RAS. SPRY4 is widely expressed, with different isoforms. The protein consists of 322 amino acids, with a cysteine-rich region, Src homology 3 binding regions, proline-rich regions, and a PEST sequence. It is expressed predominantly in the cytoplasm. Northern results show bands across most tissues, with strongest expression in heart, brain, placenta, lung, and intestine.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: BA
Species: Bv, Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: BA
Species: Hu
Applications: WB
Species: Hu
Applications: ICC, IHC, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Mu, Rb, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: BA
Publications for SPRY4 Antibody (NBP2-56160) (0)
There are no publications for SPRY4 Antibody (NBP2-56160).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for SPRY4 Antibody (NBP2-56160) (0)
There are no reviews for SPRY4 Antibody (NBP2-56160).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for SPRY4 Antibody (NBP2-56160) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional SPRY4 Products
Research Areas for SPRY4 Antibody (NBP2-56160)
Find related products by research area.
|
Blogs on SPRY4