Home » Smoothened » Smoothened Proteins » Recombinant Human Smoothened GST (N-Term) Protein
Novus Biologicals products are now on bio-techne.com

Recombinant Human Smoothened GST (N-Term) Protein

 Submit a Review

Images

 
(
Enlarge)
12.5% SDS-PAGE Stained with Coomassie Blue.
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Recombinant Human Smoothened GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 653-787 of Human Smoothened

Source: Wheat Germ (in vitro)

Amino Acid Sequence: NLWLVEAEISPELQKRLGRKKKRRKRKKEVCPLAPPPELHPPAPAPSTIPRLPQLPRQKCLVAAGAWGAGDSCRQGAWTLVSNPFCPEPSPPQDPFLPSAPAPVAWAHGRRQGLGPIHSRTNLMDTELMDADSDF
Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
SMO
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
40.37 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Smoothened GST (N-Term) Protein

  • bnb
  • CRJS
  • FZD11
  • Gx
  • Protein Gx
  • SMO
  • SMOH
  • SMOHseven transmembrane helix receptor
  • smoothened (Drosophila) homolog
  • smoothened homolog (Drosophila)
  • smoothened homolog
  • Smoothened

Background

Smoothened, a Frizzled Receptor, is homologous to the Drosophila segment polarity Smo gene. It associates with the Patched protein to mediate the cellular response to the Hedgehog secreted protein signal, which controls patterning and growth during vertebrate development. Smoothened is activated in a number of human tumors and can function as an oncogene in basal-cell carcinomas. Smoothened expression has been documented in bladder, blood, brain, the central nervous system, skin, and ureter. ESTs have been isolated from amnion, bone, brain, breast, embryo, eye, heart, nerve, and skin libraries.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Sonic Hedgehog/Shh
[Unconjugated]
464-SH
Bioactivity Sonic Hedgehog/Shh [Unconjugated]
SDS-PAGE Sonic Hedgehog/Shh [Unconjugated]
SEC-MALS Sonic Hedgehog/Shh [Unconjugated]
(65 Publications)
Species: Mu
Applications: BA
Recombinant Human
Fucosyltransferase 1/ ...
H00002523-P01
Other Recombinant Human Fucosyltransferase 1/FUT1 GST (N-Term) Protein
Species: Hu
Applications: ELISA, AP, PA, WB
HFE Antibody (1G12)
H00003077-M01
Western Blot HFE Antibody (1G12)
Immunocytochemistry/ Immunofluorescence HFE Antibody (1G12)
Western Blot HFE Antibody (1G12)
(2 Reviews)
(1 Publication)
Species: Hu
Applications: ELISA, ICC/IF, WB
Patched 1/PTCH
Antibody (413220) [Un ...
MAB41051
Immunohistochemistry Patched 1/PTCH Antibody (413220) [Unconjugated] - (First Extracellular Loop)
Western Blot Patched 1/PTCH Antibody (413220) [Unconjugated] - (First Extracellular Loop)
Immunohistochemistry Patched 1/PTCH Antibody (413220) [Unconjugated] - (First Extracellular Loop)
(10 Publications)
Species: Hu, Mu
Applications: IHC, WB
GLI-1 Antibody -
BSA Free
NB600-600
Immunohistochemistry-Paraffin GLI-1 Antibody - BSA Free
Knockdown Validated GLI-1 Antibody - BSA Free
Immunohistochemistry-Paraffin GLI-1 Antibody - BSA Free
(1 Review)
(55 Publications)
Species: Ca, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, IB, ICC/IF, IHC, IHC-P, KD, WB
Ret Antibody
[Unconjugated]
AF482
Immunohistochemistry Ret Antibody [Unconjugated]
Western Blot Ret Antibody [Unconjugated]
Immunohistochemistry Ret Antibody [Unconjugated]
(40 Publications)
Species: Mu
Applications: IHC, WB
Factor IX Antibody
NBP1-33581
Immunohistochemistry-Paraffin Factor IX Antibody
Immunohistochemistry-Paraffin Factor IX Antibody
Immunocytochemistry/ Immunofluorescence Factor IX Antibody
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P
TAS2R38 Antibody
NBP2-33404
Immunohistochemistry TAS2R38 Antibody
Species: Hu
Applications: IHC, IHC-P
CCDC6 Antibody
NBP1-85351
Immunohistochemistry-Paraffin CCDC6 Antibody
Immunohistochemistry-Paraffin CCDC6 Antibody
Immunohistochemistry-Paraffin CCDC6 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Indian
Hedgehog/Ihh Antibody ...
AF1705
Immunohistochemistry Indian Hedgehog/Ihh Antibody - N-Terminus
(3 Publications)
Species: Mu
Applications: IHC, WB
GLI-2 Antibody
AF3635
Immunohistochemistry GLI-2 Antibody
(2 Reviews)
(42 Publications)
Species: Mu
Applications: IHC, WB
SMOX Antibody -
Azide and BSA Free
NBP3-04509
Immunohistochemistry-Paraffin SMOX Antibody - Azide and BSA Free
Western Blot SMOX Antibody - Azide and BSA Free
Immunohistochemistry-Paraffin SMOX Antibody - Azide and BSA Free
(1 Publication)
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
GLI-3 Antibody
AF3690
Western Blot GLI-3 Antibody
Chromatin Immunoprecipitation (ChIP) GLI-3 Antibody
Immunocytochemistry GLI-3 Antibody
(3 Reviews)
(100 Publications)
Species: Hu, Mu
Applications: ChIP, ICC, WB
Suppressor of
Fused Antibody
NBP1-87384
Immunohistochemistry-Paraffin Suppressor of Fused Antibody
Immunocytochemistry/ Immunofluorescence Suppressor of Fused Antibody
Western Blot Suppressor of Fused Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Hip Antibody
[Unconjugated]
AF1568
Hip Antibody [Unconjugated]
(6 Publications)
Species: Mu
Applications: WB
STK36 Antibody
NBP1-83411
Immunocytochemistry/ Immunofluorescence STK36 Antibody
Immunohistochemistry-Paraffin STK36 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NDUFB6 Antibody
NBP1-92172
Immunohistochemistry-Paraffin NDUFB6 Antibody
Western Blot NDUFB6 Antibody
Immunocytochemistry/ Immunofluorescence NDUFB6 Antibody
(2 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Desert
Hedgehog/Dhh Antibody ...
AF196
Immunohistochemistry Desert Hedgehog/Dhh Antibody [Unconjugated] - C-terminus
Immunohistochemistry Desert Hedgehog/Dhh Antibody [Unconjugated] - C-terminus
(2 Publications)
Species: Mu
Applications: IHC, WB

Publications for Smoothened Partial Recombinant Protein (H00006608-Q02) (0)

There are no publications for Smoothened Partial Recombinant Protein (H00006608-Q02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Smoothened Partial Recombinant Protein (H00006608-Q02) (0)

There are no reviews for Smoothened Partial Recombinant Protein (H00006608-Q02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Smoothened Partial Recombinant Protein (H00006608-Q02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Smoothened Products

Research Areas for Smoothened Partial Recombinant Protein (H00006608-Q02)

Find related products by research area.

Blogs on Smoothened.

Check out the latest blog posts on Smoothened.
The role of Smoothened in pulmonary pathologies
The Hedgehog (Hh) family of secreted proteins is involved in a number of developmental processes, one of which is the development of cancer. Past data suggests that the Sonic hedgehog (Shh) receptor is composed of two transmembrane proteins, Patche...  Read full blog post.
Pancreatic Cancer Research Targets Hedgehog Signaling Pathway
The Hedgehog Signaling Pathway (HSP) is an important pathway involved in embryonic development by regulating cell differentiation. This pathway has also become an increasingly hot topic in cancer research in recent years. The HSP involves the interact...  Read full blog post.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Western blot shows lysates of mouse embryo tissue. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human/Mouse GLI-3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3690) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for GLI-3 at approximately 85 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
GLI-3 Antibody
AF3690
Immunohistochemistry-Paraffin: GLI-1 Antibody [NB600-600] - Staining in canine hair follicle. Image from a verified customer review.
GLI-1 Antibody - BSA Free
NB600-600

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Smoothened GST (N-Term) Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol SMO