Slit1 Antibody Summary
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human Slit1. Peptide sequence: GAHCVCDPGFSGELCEQESECRGDPVRDFHQVQRGYAICQTTRPLSWVEC The peptide sequence for this immunogen was taken from within the described region. |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
SLIT1 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry
- Immunohistochemistry-Paraffin
- Western Blot 1.0 ug/ml
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS, 2% Sucrose |
Preservative |
0.09% Sodium Azide |
Concentration |
0.5 mg/ml |
Purity |
Affinity purified |
Alternate Names for Slit1 Antibody
Background
SLIT-1 (also known as KIAA0813, MEGF4, multiple epidermal growth factor-like domains 4 and Slit homolog 1 protein) is a Slit protein. This protein is a ligand for the Roundabout (Robo) receptors and acts as guidance cues in axonal migration/navigation during neural development, at the ventral midline of the neural tube. Slit1 and Slit2 are essential for midline guidance in the forebrain by acting as repulsive signals preventing inappropriate midline crossing by axons projecting from the olfactory bulb. Each SLIT gene encodes a putative secreted protein, which contains conserved protein-protein interaction domains including leucine-rich repeats and epidermal growth factor-like motifs, similar to those of the Drosophila protein. In situ hybridization studies indicated that the rat SLIT-1 mRNA was specifically expressed in the neurons of fetal and adult forebrains. This data suggests that the SLIT genes form an evolutionarily conserved group in vertebrates and invertebrates, and that the mammalian SLIT proteins may participate in the formation and maintenance of the nervous and endocrine systems by protein-protein interactions. Alternative splicing isoforms have been identified for Slit1 protein.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu
Applications: BA
Species: Rt
Applications: IHC, WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC, WB
Species: Mu
Applications: Bind
Species: Hu
Applications: IHC, WB
Species: Mu
Applications: Block, IHC, WB
Species: Hu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: WB
Species: Hu, Mu
Applications: Block, IHC
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Fe, Hu, RM
Applications: BA, BA
Publications for Slit1 Antibody (NBP2-84269) (0)
There are no publications for Slit1 Antibody (NBP2-84269).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Slit1 Antibody (NBP2-84269) (0)
There are no reviews for Slit1 Antibody (NBP2-84269).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Slit1 Antibody (NBP2-84269) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Slit1 Products
Research Areas for Slit1 Antibody (NBP2-84269)
Find related products by research area.
|
Blogs on Slit1