![Western Blot: SFXN1 Antibody [NBP1-83708] - Analysis in human cell line CACO-2 and human cell line PC-3.](http://images.novusbio.com/fullsize/SFXN1-Antibody-Western-Blot-NBP1-83708-img0014.jpg "Western Blot: SFXN1 Antibody [NBP1-83708] - Analysis in human cell line CACO-2 and human cell line PC-3.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SGELPPNINIKEPRWDQSTFIGRANHFFTVTDPRNILLTNEQLESARKIVHDYRQGIVPPGLTENELWRAKYIYDSAFHPDTGEKMILIGRMSAQV |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SFXN1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunohistochemistry_20892.jpg)
![Immunocytochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunocytochemistry__Immunofluorescence_21143.jpg)
![Western Blot EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Western_Blot_19925.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SFXN1 |
![Western Blot: SFXN1 Antibody [NBP1-83708] - Analysis using Anti-SFXN1 antibody NBP1-83708 (A) shows similar pattern to independent antibody NBP2-57172 (B).](http://images.novusbio.com/fullsize/SFXN1-Antibody-Western-Blot-NBP1-83708-img0016.jpg "Western Blot: SFXN1 Antibody [NBP1-83708] - Analysis using Anti-SFXN1 antibody NBP1-83708 (A) shows similar pattern to independent antibody NBP2-57172 (B).")
![Immunocytochemistry/Immunofluorescence: SFXN1 Antibody [NBP1-83708] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.](http://images.novusbio.com/fullsize/SFXN1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-83708-img0009.jpg "Immunocytochemistry/Immunofluorescence: SFXN1 Antibody [NBP1-83708] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.")
![Immunohistochemistry-Paraffin: SFXN1 Antibody [NBP1-83708] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/SFXN1-Antibody-Immunohistochemistry-Paraffin-NBP1-83708-img0013.jpg "Immunohistochemistry-Paraffin: SFXN1 Antibody [NBP1-83708] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
![Western Blot: SFXN1 Antibody [NBP1-83708] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize/SFXN1-Antibody-Western-Blot-NBP1-83708-img0015.jpg "Western Blot: SFXN1 Antibody [NBP1-83708] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.")
![Immunohistochemistry-Paraffin: SFXN1 Antibody [NBP1-83708] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.](http://images.novusbio.com/fullsize/SFXN1-Antibody-Immunohistochemistry-Paraffin-NBP1-83708-img0010.jpg "Immunohistochemistry-Paraffin: SFXN1 Antibody [NBP1-83708] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.")
![Immunohistochemistry-Paraffin: SFXN1 Antibody [NBP1-83708] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/SFXN1-Antibody-Immunohistochemistry-Paraffin-NBP1-83708-img0011.jpg "Immunohistochemistry-Paraffin: SFXN1 Antibody [NBP1-83708] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: SFXN1 Antibody [NBP1-83708] - Staining of human liver shows very strong granular cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/fullsize/SFXN1-Antibody-Immunohistochemistry-Paraffin-NBP1-83708-img0012.jpg "Immunohistochemistry-Paraffin: SFXN1 Antibody [NBP1-83708] - Staining of human liver shows very strong granular cytoplasmic positivity in hepatocytes.")
![Bioactivity IL-4 [Unconjugated]](https://images.novusbio.com/images/protein/6507-ilcf_recombinant-human-il-4-cho-expressed-protein-cf-bioactivity-272020133214.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Bioactivity IL-2 [Unconjugated]](https://images.novusbio.com/images/202-il_recombinant-human-il-2-protein-bioactivity-174202314946.jpg)
![N/A Complement Component C5a [Biotin]](https://images.novusbio.com/images2/DATA_Complement_Component_C5a_DY2037_ELISA_1753.jpg)
![Bioactivity IFN-gamma [Unconjugated]](https://images.novusbio.com/images2/IFNgamma_285IF_2848.jpg)
![SDS-PAGE IFN-gamma [Unconjugated]](https://images.novusbio.com/images2/IFN-gamma_285-IF_230.jpg)
![SEC-MALS IFN-gamma [Unconjugated]](https://images.novusbio.com/images/285-if_recombinant-human-ifn-gamma-protein-sec-mals-1520239228..jpg)
![Simple Western Aldo-keto Reductase 1C1/AKR1C1 Antibody (859026) [Unconjugated]](https://images.novusbio.com/images2/Aldoketo_Reductase_1C1_MAB6529_Simple_Western_17147.jpg)
![Western Blot Aldo-keto Reductase 1C1/AKR1C1 Antibody (859026) [Unconjugated]](https://images.novusbio.com/images2/Aldoketo_Reductase_1C1_MAB6529_Western_Blot_13068.jpg)
![N/A CXCL10/IP-10/CRG-2 [HRP]](https://images.novusbio.com/images2/DATA_CXCL10_DIP100_ELISA_723.jpg)
![N/A CXCL10/IP-10/CRG-2 [HRP]](https://images.novusbio.com/images2/DATA_CXCL10_DIP100_ELISA_724.jpg)
![N/A CXCL10/IP-10/CRG-2 [HRP]](https://images.novusbio.com/images2/CXCL10_DIP100_ELISA_121.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")