Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VLRHVNGQDQIVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACALSIEESCRPGDKVPPIKPNAGEES |
Predicted Species | Mouse (94%), Rat (96%). Backed by our 100% Guarantee. |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | SDHA |
Purity | Affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
||
Application Notes | ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
Control Peptide |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.2) and 40% Glycerol |
Preservative | 0.02% Sodium Azide |
Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for SDHA Antibody (NBP2-56988)Find related products by research area.
|
SDHA - oxidative enzyme in the citric acid cycle Succinate dehydrogenase is an important tetrameric protein involved in the citric acid cycle. It is localized to the inner mitochondrial membrane of cells. Succinate dehydrogenase makes up Complex II of the electron transport chain (ETC) and is re... Read full blog post. |
SDHA - An essential Krebs cycle enzyme with role in cancer and metabolism Succinate dehydrogenase (SDH) is a highly conserved protein complex located on the inner mitochondrial membrane where it functions during the Krebs cycle by oxidizing succinate to fumarate (1). This reaction is also important for feeding electrons ... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | SDHA |