Home » ROBO4 » ROBO4 Proteins » ROBO4 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

ROBO4 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for ROBO4 Recombinant Protein Antigen (NBP2-57071PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

ROBO4 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ROBO4.

Source: E. coli

Amino Acid Sequence: PAENHNGIIRGYQVWSLGNTSLPPANWTVVGEQTQLEIATHMPGSYCVQVAAVTGAGAGEPSRPVCLLLEQAMERATQEPSEHGPW

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ROBO4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57071.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.
Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ROBO4 Recombinant Protein Antigen

  • ECSM4
  • FLJ20798
  • Magic roundabout
  • MGC133352
  • MGC133353
  • MRB
  • ROBO4
  • roundabout homolog 4
  • roundabout homolog 4, magic roundabout (Drosophila)

Background

Roundabouts (ROBO) are cell-surface receptors that mediate repulsive signaling mechanisms at the central nervous system midline. However, ROBOs may also mediate attraction mechanisms in the context of vascular development. ROBO4 is a novel roundabout protein which is restricted in expression to endothelial cells in vitro and sites of angiogenesis in vivo. Because it is not expressed on normal endothelial cells in vivo, it is a promising tumor endothelial marker.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Slit2
[Unconjugated]
5444-SL
Slit2 [Unconjugated]
(12 Publications)
Species: Mu
Applications: BA
Slit3 Antibody
(782619)
MAB3629
Immunohistochemistry Slit3 Antibody (782619)
(1 Publication)
Species: Mu
Applications: IHC
ROBO1 Antibody
AF1749
Immunohistochemistry ROBO1 Antibody
Immunohistochemistry ROBO1 Antibody
(11 Publications)
Species: Rt
Applications: IHC, WB
VEGF [HRP]
DVE00
N/A VEGF [HRP]
N/A VEGF [HRP]
N/A VEGF [HRP]
(674 Publications)
Species: Hu
Applications: ELISA
Slit1
[Unconjugated]
6514-SL
Slit1 [Unconjugated]
(2 Publications)
Species: Hu
Applications: BA
ROBO2 Antibody
[Unconjugated]
AF3147
ROBO2 Antibody [Unconjugated]
(10 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, ICC, WB
Mineralocorticoid
R/NR3C2 Antibody (H10 ...
NB300-562
Immunohistochemistry-Paraffin Mineralocorticoid R/NR3C2 Antibody (H10E4C9F) - BSA Free
Western Blot Mineralocorticoid R/NR3C2 Antibody (H10E4C9F) - BSA Free
Immunocytochemistry/ Immunofluorescence Mineralocorticoid R/NR3C2 Antibody (H10E4C9F) - BSA Free
(2 Publications)
Species: Ch, Hu, Mu, Rb, Rt, Sh
Applications: B/N, Flow, ICC/IF, IHC, IHC-P, WB
ACE/CD143 Antibody
[Unconjugated]
AF1513
Immunohistochemistry ACE/CD143 Antibody [Unconjugated]
Western Blot ACE/CD143 Antibody [Unconjugated]
Simple Western ACE/CD143 Antibody [Unconjugated]
(1 Review)
(7 Publications)
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
ROBO3 Antibody
AF3076
ROBO3 Antibody
(1 Review)
(23 Publications)
Species: Hu
Applications: IHC, WB

SLC6A2/NET/Noradrenali ...
NBP3-12251
Western Blot SLC6A2/NET/Noradrenaline transporter Antibody
Immunohistochemistry-Paraffin SLC6A2/NET/Noradrenaline transporter Antibody
Immunohistochemistry-Paraffin SLC6A2/NET/Noradrenaline transporter Antibody
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
WASP Antibody
NB300-996
Immunohistochemistry-Paraffin WASP Antibody
Immunocytochemistry/ Immunofluorescence WASP Antibody
Immunocytochemistry/ Immunofluorescence WASP Antibody
(1 Publication)
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Serpin
A8/Angiotensinogen An ...
NBP1-30027
Immunohistochemistry-Paraffin Serpin A8/Angiotensinogen Antibody - BSA Free
Western Blot Serpin A8/Angiotensinogen Antibody - BSA Free
Immunohistochemistry-Paraffin Serpin A8/Angiotensinogen Antibody - BSA Free
(11 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Bestrophin 1
Antibody (E6-6) - BSA
NB300-164
Knockout Validated Bestrophin 1 Antibody (E6-6) - BSA Free
Immunohistochemistry-Paraffin Bestrophin 1 Antibody (E6-6) - BSA Free
Immunohistochemistry-Paraffin Bestrophin 1 Antibody (E6-6) - BSA Free
(1 Review)
(49 Publications)
Species: Ca, Hu, Mu, Po, Pm, Rt(-)
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO, PLA, WB
ACE-2 Antibody
[Unconjugated]
AF933
Simple Western ACE-2 Antibody [Unconjugated]
Immunohistochemistry ACE-2 Antibody [Unconjugated]
Immunohistochemistry ACE-2 Antibody [Unconjugated]
(1 Review)
(282 Publications)
Species: Ha, Hu, Mu, Rt
Applications: Block, Flow, IHC, IP, Simple Western, WB
VEGFR2/KDR/Flk-1
Antibody [Unconjugate ...
AF644
Neutralization VEGFR2/KDR/Flk-1 Antibody [Unconjugated]
Immunohistochemistry VEGFR2/KDR/Flk-1 Antibody [Unconjugated]
Immunohistochemistry VEGFR2/KDR/Flk-1 Antibody [Unconjugated]
(3 Reviews)
(97 Publications)
Species: Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Neut, WB
HPRT Antibody
NBP1-33527
Western Blot HPRT Antibody
Western Blot HPRT Antibody
Immunohistochemistry-Paraffin HPRT Antibody
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AKT [p Ser473]
Antibody [Unconjugate ...
AF887
Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
(49 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Carbonic Anhydrase
VIII/CA8 Antibody [Un ...
AF2187
Western Blot Carbonic Anhydrase VIII/CA8 Antibody [Unconjugated]
Simple Western Carbonic Anhydrase VIII/CA8 Antibody [Unconjugated]
Species: Hu, Mu
Applications: IP, Simple Western, WB
UNC5H2/UNC5B
Antibody [Unconjugate
AF1006
Western Blot UNC5H2/UNC5B Antibody [Unconjugated]
Immunohistochemistry UNC5H2/UNC5B Antibody [Unconjugated]
Western Blot UNC5H2/UNC5B Antibody [Unconjugated]
(16 Publications)
Species: Rt
Applications: IHC, WB
ROBO4 Recombinant
Protein Antigen
NBP2-57071PEP
ROBO4 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for ROBO4 Recombinant Protein Antigen (NBP2-57071PEP) (0)

There are no publications for ROBO4 Recombinant Protein Antigen (NBP2-57071PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ROBO4 Recombinant Protein Antigen (NBP2-57071PEP) (0)

There are no reviews for ROBO4 Recombinant Protein Antigen (NBP2-57071PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ROBO4 Recombinant Protein Antigen (NBP2-57071PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ROBO4 Products

Research Areas for ROBO4 Recombinant Protein Antigen (NBP2-57071PEP)

Find related products by research area.

Blogs on ROBO4

There are no specific blogs for ROBO4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Simple Western lane view shows lysates of human kidney tissue, loaded at 0.2 mg/mL. A specific band was detected for ACE‑2 at approximately 155 kDa (as indicated) using 10 µg/mL of Goat Anti-Human ACE‑2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF933) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
ACE-2 Antibody [Unconjugated]
AF933

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ROBO4 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol ROBO4