![Western Blot: PSMA2 Antibody [NBP1-92292] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented. Loading control: Anti-GAPDH.](http://images.novusbio.com/fullsize/PSMA2-Antibody-Western-Blot-NBP1-92292-img0009.jpg "Western Blot: PSMA2 Antibody [NBP1-92292] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented. Loading control: Anti-GAPDH.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC, KD |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SGAYFAWKATAMGKNYVNGKTFLEKRYNEDLELEDAIHTAILTLKESFEGQMTEDNIEVGICNEAGFRRLTPTEVKDYLAAIA |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PSMA2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-92292 | Applications | Species |
|---|---|---|
| Geiger T, Velic A, Macek B et al. Initial Quantitative Proteomic Map of 28 Mouse Tissues Using the SILAC Mouse. Mol Cell Proteomics 2013-06-01 [PMID: 23436904] |
Secondary Antibodies |
Isotype Controls |
Research Areas for Proteasome 20S alpha 2 Antibody (NBP1-92292)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PSMA2 |
![Immunohistochemistry-Paraffin: PSMA2 Antibody [NBP1-92292] - Staining of human testis shows moderate nuclear and cytoplasmic positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/PSMA2-Antibody-Immunohistochemistry-Paraffin-NBP1-92292-img0013.jpg "Immunohistochemistry-Paraffin: PSMA2 Antibody [NBP1-92292] - Staining of human testis shows moderate nuclear and cytoplasmic positivity in cells in seminiferous ducts.")
![Western Blot: PSMA2 Antibody [NBP1-92292] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize/PSMA2-Antibody-Western-Blot-NBP1-92292-img0007.jpg "Western Blot: PSMA2 Antibody [NBP1-92292] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.")
![Immunohistochemistry-Paraffin: PSMA2 Antibody [NBP1-92292] - Staining of human cerebellum shows strong nuclear positivity in Purkinje cells.](http://images.novusbio.com/fullsize/PSMA2-Antibody-Immunohistochemistry-Paraffin-NBP1-92292-img0010.jpg "Immunohistochemistry-Paraffin: PSMA2 Antibody [NBP1-92292] - Staining of human cerebellum shows strong nuclear positivity in Purkinje cells.")
![Immunohistochemistry-Paraffin: PSMA2 Antibody [NBP1-92292] - Staining of human cervix, uterine shows no positivity in squamous epithelial cells as expected.](http://images.novusbio.com/fullsize/PSMA2-Antibody-Immunohistochemistry-Paraffin-NBP1-92292-img0011.jpg "Immunohistochemistry-Paraffin: PSMA2 Antibody [NBP1-92292] - Staining of human cervix, uterine shows no positivity in squamous epithelial cells as expected.")
![Immunohistochemistry-Paraffin: PSMA2 Antibody [NBP1-92292] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/fullsize/PSMA2-Antibody-Immunohistochemistry-Paraffin-NBP1-92292-img0012.jpg "Immunohistochemistry-Paraffin: PSMA2 Antibody [NBP1-92292] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.")
![Western Blot Serpin A1/alpha 1-Antitrypsin Antibody (202808) [Unconjugated]](https://images.novusbio.com/images2/Serpin_A1_MAB1268_Western_Blot_17309.jpg)
![Simple Western Serpin A1/alpha 1-Antitrypsin Antibody (202808) [Unconjugated]](https://images.novusbio.com/images2/Serpin_A1_MAB1268_Immunocytochemistry__Immunofluorescence_17494.jpg)
![Immunocytochemistry Serpin A1/alpha 1-Antitrypsin Antibody (202808) [Unconjugated]](https://images.novusbio.com/images2/Serpin_A1_MAB1268_Immunocytochemistry_11973.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")