![Western Blot: PSMA1 Antibody [NBP1-81768] - Analysis using Anti-PSMA1 antibody NBP1-81768 (A) shows similar pattern to independent antibody NBP2-37908 (B).](http://images.novusbio.com/fullsize/Proteasome-20S-C2-Antibody-Western-Blot-NBP1-81768-img0009.jpg "Western Blot: PSMA1 Antibody [NBP1-81768] - Analysis using Anti-PSMA1 antibody NBP1-81768 (A) shows similar pattern to independent antibody NBP2-37908 (B).")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SQSARTYLERHMSEFMECNLNELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDLEFTIYDDDDVSPFLEGLEERPQRKAQPAQPADEP |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PSMA1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunohistochemistry_20892.jpg)
![Immunocytochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunocytochemistry__Immunofluorescence_21143.jpg)
![Western Blot EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Western_Blot_19925.jpg)
![Immunocytochemistry Granzyme A Antibody [Unconjugated]](https://images.novusbio.com/images2/Granzyme_A_AF2905_Immunocytochemistry_10939.jpg)
![ELISA Granzyme A Antibody [Unconjugated]](https://images.novusbio.com/images2/Granzyme_A_AF2905_ELISA_22249.jpg)
![Western Blot Granzyme A Antibody [Unconjugated]](https://images.novusbio.com/images2/Granzyme_A_AF2905_Western_Blot_23415.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for PSMA1 Antibody (NBP1-81768)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: PSMA1 Antibody [NBP1-81768] - Staining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/Proteasome-20S-C2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-81768-img0007.jpg "Immunocytochemistry/Immunofluorescence: PSMA1 Antibody [NBP1-81768] - Staining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: PSMA1 Antibody [NBP1-81768] - Staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/Proteasome-20S-C2-Antibody-Immunohistochemistry-Paraffin-NBP1-81768-img0011.jpg "Immunohistochemistry-Paraffin: PSMA1 Antibody [NBP1-81768] - Staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.")
![Western Blot: PSMA1 Antibody [NBP1-81768] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).](http://images.novusbio.com/fullsize/Proteasome-20S-C2-Antibody-Western-Blot-NBP1-81768-img0006.jpg "Western Blot: PSMA1 Antibody [NBP1-81768] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).")
![Immunohistochemistry-Paraffin: PSMA1 Antibody [NBP1-81768] - Staining of human testis shows distinct cytoplasmic and nuclear positivity in cells in seminiferus ducts and Leydig cells.](http://images.novusbio.com/fullsize/Proteasome-20S-C2-Antibody-Immunohistochemistry-Paraffin-NBP1-81768-img0008.jpg "Immunohistochemistry-Paraffin: PSMA1 Antibody [NBP1-81768] - Staining of human testis shows distinct cytoplasmic and nuclear positivity in cells in seminiferus ducts and Leydig cells.")
![Immunohistochemistry-Paraffin: PSMA1 Antibody [NBP1-81768] - Staining of human cervix, uterine shows moderate to strong nuclear positivity in squamous epithelial cells.](http://images.novusbio.com/fullsize/Proteasome-20S-C2-Antibody-Immunohistochemistry-Paraffin-NBP1-81768-img0010.jpg "Immunohistochemistry-Paraffin: PSMA1 Antibody [NBP1-81768] - Staining of human cervix, uterine shows moderate to strong nuclear positivity in squamous epithelial cells.")
![Immunohistochemistry-Paraffin: PSMA1 Antibody [NBP1-81768] - Staining of human endometrium shows moderate to strong nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/Proteasome-20S-C2-Antibody-Immunohistochemistry-Paraffin-NBP1-81768-img0012.jpg "Immunohistochemistry-Paraffin: PSMA1 Antibody [NBP1-81768] - Staining of human endometrium shows moderate to strong nuclear positivity in glandular cells.")
![Bioactivity IL-2 [Unconjugated]](https://images.novusbio.com/images/202-il_recombinant-human-il-2-protein-bioactivity-174202314946.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_871.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_872.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/VEGF_DVE00_ELISA_208.jpg)
![Western Blot Prostatic Acid Phosphatase/ACPP Antibody [Unconjugated]](https://images.novusbio.com/images2/Prostatic_Acid_Phosphatase_AF6240_Western_Blot_10680.jpg)
![Immunohistochemistry Prostatic Acid Phosphatase/ACPP Antibody [Unconjugated]](https://images.novusbio.com/images2/Prostatic_Acid_Phosphatase_AF6240_Immunohistochemistry_10732.jpg)
![ELISA Prostatic Acid Phosphatase/ACPP Antibody [Unconjugated]](https://images.novusbio.com/images2/Prostatic_Acid_Phosphatase_AF6240_ELISA_22233.jpg)
![Immunohistochemistry Complement Factor H Antibody [Unconjugated]](https://images.novusbio.com/images2/Complement_Factor_H_AF4779_Immunohistochemistry_7182.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")