![Western Blot: PGAM5 Antibody [NBP1-92257] - Analysis in RT-4 cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented. Loading control: Anti-PPIB.](http://images.novusbio.com/fullsize/PGAM5-Antibody-Western-Blot-NBP1-92257-img0018.jpg "Western Blot: PGAM5 Antibody [NBP1-92257] - Analysis in RT-4 cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented. Loading control: Anti-PPIB.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, Simple Western, ICC/IF, IHC, KD |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: NWDRREPLSLINVRKRNVESGEEELASKLDHYKAKATRHIFLIRHSQYHVDGSLEKDRTLTPLGREQAELTGLRLASLGLKFNKIV |
| Predicted Species | Mouse (94%), Rat (92%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PGAM5 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue. |
||
| Theoretical MW | 32 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-92257 | Applications | Species |
|---|---|---|
| Marzio A, Kurz E, Sahni JM et al. EMSY inhibits homologous recombination repair and the interferon response, promoting lung cancer immune evasion Cell 2022-01-06 [PMID: 34963055] (WB, Human) | WB | Human |
| Images | Ratings | Applications | Species | Date | Details | ||||
|---|---|---|---|---|---|---|---|---|---|
|
reviewed by:
Yongkang Yang |
WB | 12/20/2023 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Research Areas for PGAM5 Antibody (NBP1-92257)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: PGAM5 Antibody [NBP1-92257] - Staining of human colon, liver, testis and tonsil using Anti-PGAM5 antibody NBP1-92257 (A) shows similar protein distribution across tissues to independent antibody NBP1-92258 (B).](http://images.novusbio.com/fullsize/PGAM5-Antibody-Immunohistochemistry-Paraffin-NBP1-92257-img0020.jpg "Immunohistochemistry-Paraffin: PGAM5 Antibody [NBP1-92257] - Staining of human colon, liver, testis and tonsil using Anti-PGAM5 antibody NBP1-92257 (A) shows similar protein distribution across tissues to independent antibody NBP1-92258 (B).")
![Immunocytochemistry/Immunofluorescence: PGAM5 Antibody [NBP1-92257] - Staining of human cell line MCF7 shows localization to mitochondria. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/PGAM5-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-92257-img0016.jpg "Immunocytochemistry/Immunofluorescence: PGAM5 Antibody [NBP1-92257] - Staining of human cell line MCF7 shows localization to mitochondria. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: PGAM5 Antibody [NBP1-92257] - Staining of human colon shows moderate granular cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/PGAM5-Antibody-Immunohistochemistry-Paraffin-NBP1-92257-img0024.jpg "Immunohistochemistry-Paraffin: PGAM5 Antibody [NBP1-92257] - Staining of human colon shows moderate granular cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: PGAM5 Antibody [NBP1-92257] - Staining of human liver shows moderate granular cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/fullsize/PGAM5-Antibody-Immunohistochemistry-Paraffin-NBP1-92257-img0021.jpg "Immunohistochemistry-Paraffin: PGAM5 Antibody [NBP1-92257] - Staining of human liver shows moderate granular cytoplasmic positivity in hepatocytes.")
![Immunohistochemistry-Paraffin: PGAM5 Antibody [NBP1-92257] - Staining of human testis shows moderate granular cytoplasmic positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/PGAM5-Antibody-Immunohistochemistry-Paraffin-NBP1-92257-img0022.jpg "Immunohistochemistry-Paraffin: PGAM5 Antibody [NBP1-92257] - Staining of human testis shows moderate granular cytoplasmic positivity in cells in seminiferous ducts.")
![Immunohistochemistry-Paraffin: PGAM5 Antibody [NBP1-92257] - Staining of human tonsil shows moderate granular cytoplasmic positivity in germinal center cells](http://images.novusbio.com/fullsize/PGAM5-Antibody-Immunohistochemistry-Paraffin-NBP1-92257-img0023.jpg "Immunohistochemistry-Paraffin: PGAM5 Antibody [NBP1-92257] - Staining of human tonsil shows moderate granular cytoplasmic positivity in germinal center cells")
![Simple Western: PGAM5 Antibody [NBP1-92257] - Simple Western lane view shows a specific band for PGAM5 in 0.2 mg/ml of RT-4 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.](http://images.novusbio.com/fullsize/PGAM5-Antibody-Simple-Western-NBP1-92257-img0007.jpg "Simple Western: PGAM5 Antibody [NBP1-92257] - Simple Western lane view shows a specific band for PGAM5 in 0.2 mg/ml of RT-4 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.")
![Simple Western: PGAM5 Antibody [NBP1-92257] - Electropherogram image(s) of corresponding Simple Western lane view. PGAM5 antibody was used at 1:60 dilution on RT-4 lysate(s).](http://images.novusbio.com/fullsize/PGAM5-Antibody-Simple-Western-NBP1-92257-img0009.jpg "Simple Western: PGAM5 Antibody [NBP1-92257] - Electropherogram image(s) of corresponding Simple Western lane view. PGAM5 antibody was used at 1:60 dilution on RT-4 lysate(s).")
![Western Blot: Rabbit Polyclonal PGAM5 Antibody [NBP1-92257] - Whole cell lysates from MDA-MB-231, SUM159 and MCF-7 cells were loaded with 50 ug/lane. 10% SDS-PAGE. PGAM5 Antibody (NBP1-92257) was used for primary antibody: 1:1000, 4C, overnight. Image from a verified customer review.](http://images.novusbio.com/fullsize/antibody/nbp1-92257_rabbit-polyclonal-pgam5-antibody-western-blot-311202415449..png "Western Blot: Rabbit Polyclonal PGAM5 Antibody [NBP1-92257] - Whole cell lysates from MDA-MB-231, SUM159 and MCF-7 cells were loaded with 50 ug/lane. 10% SDS-PAGE. PGAM5 Antibody (NBP1-92257) was used for primary antibody: 1:1000, 4C, overnight. Image from a verified customer review.")
![Western Blot Keap1 Antibody (333116) [Unconjugated]](https://images.novusbio.com/images2/Keap1_MAB3024_Western_Blot_6061.jpg)
![Simple Western Keap1 Antibody (333116) [Unconjugated]](https://images.novusbio.com/images2/Keap1_MAB3024_Simple_Western_16632.jpg)
![Knockout Validated Keap1 Antibody (333116) [Unconjugated]](https://images.novusbio.com/images2/Keap1_MAB3024_Knockout_Validated_23684.jpg)
![Immunohistochemistry-Paraffin MLKL [p Ser345] Antibody (JM92-37)](https://images.novusbio.com/images/MLKL-p-Ser345-Antibody-JM92-37-Immunohistochemistry-Paraffin-NBP2-66953-img0001.jpg)
![Immunohistochemistry-Paraffin MLKL [p Ser345] Antibody (JM92-37)](https://images.novusbio.com/images/MLKL-p-Ser345-Antibody-JM92-37-Immunohistochemistry-Paraffin-NBP2-66953-img0002.jpg)
![Immunohistochemistry-Paraffin MLKL [p Ser345] Antibody (JM92-37)](https://images.novusbio.com/images/MLKL-p-Ser345-Antibody-JM92-37-Immunohistochemistry-Paraffin-NBP2-66953-img0003.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
