![Immunocytochemistry/Immunofluorescence: PFTK1 Antibody [NBP1-80920] - Staining of human cell line U-2 OS shows localization to nucleus & cytosol. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/PFTK1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-80920-img0004.jpg "Immunocytochemistry/Immunofluorescence: PFTK1 Antibody [NBP1-80920] - Staining of human cell line U-2 OS shows localization to nucleus & cytosol. Antibody staining is shown in green.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: DDTTFDEICVTKMSTRNCQGMDSVIKPLDTIPEDKKVRVQRTQSTFDPFEKPANQVKRVHSENNACINFKTSSTGKESPKVRRHSSPSSPTSPKFGKADSYEKLEKLGEGSYATVYKGKSKVNG |
| Predicted Species | Mouse (96%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CDK14 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-80920 | Applications | Species |
|---|---|---|
| Miyagaki H, Yamasaki M, Miyata H et al. Overexpression of PFTK1 predicts resistance to chemotherapy in patients with oesophageal squamous cell carcinoma. Br J Cancer 2012-02-28 [PMID: 22333595] |
Secondary Antibodies |
Isotype Controls |
Research Areas for PFTK1 Antibody (NBP1-80920)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: PFTK1 Antibody [NBP1-80920] - Staining of human Skeletal muscle shows very weak cytoplasmic positivity in myocytes.](http://images.novusbio.com/fullsize/PFTK1-Antibody-Immunohistochemistry-Paraffin-NBP1-80920-img0007.jpg "Immunohistochemistry-Paraffin: PFTK1 Antibody [NBP1-80920] - Staining of human Skeletal muscle shows very weak cytoplasmic positivity in myocytes.")
![Immunohistochemistry-Paraffin: PFTK1 Antibody [NBP1-80920] - Staining of human cerebral cortex shows cytoplasmic positivity in neuronal cells.](http://images.novusbio.com/fullsize/PFTK1-Antibody-Immunohistochemistry-Paraffin-NBP1-80920-img0001.jpg "Immunohistochemistry-Paraffin: PFTK1 Antibody [NBP1-80920] - Staining of human cerebral cortex shows cytoplasmic positivity in neuronal cells.")
![Immunohistochemistry-Paraffin: PFTK1 Antibody [NBP1-80920] - Staining of human Cerebral cortex shows moderate cytoplasmic positivity in neuronal cells.](http://images.novusbio.com/fullsize/PFTK1-Antibody-Immunohistochemistry-Paraffin-NBP1-80920-img0005.jpg "Immunohistochemistry-Paraffin: PFTK1 Antibody [NBP1-80920] - Staining of human Cerebral cortex shows moderate cytoplasmic positivity in neuronal cells.")
![Immunohistochemistry-Paraffin: PFTK1 Antibody [NBP1-80920] - Staining of human Kidney shows moderate cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/PFTK1-Antibody-Immunohistochemistry-Paraffin-NBP1-80920-img0006.jpg "Immunohistochemistry-Paraffin: PFTK1 Antibody [NBP1-80920] - Staining of human Kidney shows moderate cytoplasmic positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: PFTK1 Antibody [NBP1-80920] - Staining of human Testis shows moderate cytoplasmic positivity in cells in seminiferous ducts and leydig cells.](http://images.novusbio.com/fullsize/PFTK1-Antibody-Immunohistochemistry-Paraffin-NBP1-80920-img0008.jpg "Immunohistochemistry-Paraffin: PFTK1 Antibody [NBP1-80920] - Staining of human Testis shows moderate cytoplasmic positivity in cells in seminiferous ducts and leydig cells.")
![Flow Cytometry LRP-6 Antibody (255302) [Unconjugated]](https://images.novusbio.com/images2/LRP-6_MAB1505_Flow_Cytometry_11214.jpg)
![Immunocytochemistry LRP-6 Antibody (255302) [Unconjugated]](https://images.novusbio.com/images2/LRP-6_MAB1505_Immunocytochemistry_11355.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")