![Western Blot: p63/TP73L Antibody (CL3748) [NBP3-05501] - Analysis in human cell line RT-4 and human cell line U-251 MG.](http://images.novusbio.com/fullsize/p63-TP73L-Antibody-CL3748-Western-Blot-NBP3-05501-img0007.jpg "Western Blot: p63/TP73L Antibody (CL3748) [NBP3-05501] - Analysis in human cell line RT-4 and human cell line U-251 MG.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clone | CL3748 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: CACPGRDRKADEDSIRKQQVSDSTKNGDAFRQNTHGIQMTSIKKRRSPDDELLYLPVRGRETYEMLLKIKESLELMQYLPQHTIETYRQQQQQQHQ |
| Epitope | MQYLPQHTIETYRQQ |
| Predicted Species | Mouse (99%), Rat (94%). Backed by our 100% Guarantee. |
| Isotype | IgG1 |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | TP63 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, pH 7.2, containing 40% glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Protein A purified |
![Simple Western GCHFR Antibody (846011) [Unconjugated]](https://images.novusbio.com/images2/GCHFR_MAB7918_Simple_Western_16530.jpg)
![Western Blot GCHFR Antibody (846011) [Unconjugated]](https://images.novusbio.com/images2/GCHFR_MAB7918_Western_Blot_13066.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for p63/TP73L Antibody (NBP3-05501)Find related products by research area.
|
|
Spheroids vs. Organoids: Which 3D Cell Culture Model is Best for You? By Jennifer Jones, M.S.Spheroids and organoids are two words that, like “butter” and “margarine”, are often referred to interchangeably but have distinct meanings. The progression and adopt... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TP63 |
![Immunohistochemistry-Paraffin: p63/TP73L Antibody (CL3748) [NBP3-05501] - Staining of human prostate shows nuclear immunoreactivity in basal epithelial cells.](http://images.novusbio.com/fullsize/p63-TP73L-Antibody-CL3748-Immunohistochemistry-Paraffin-NBP3-05501-img0006.jpg "Immunohistochemistry-Paraffin: p63/TP73L Antibody (CL3748) [NBP3-05501] - Staining of human prostate shows nuclear immunoreactivity in basal epithelial cells.")
![Immunohistochemistry-Paraffin: p63/TP73L Antibody (CL3748) [NBP3-05501] - Staining of human cervix shows strong nuclear immunoreactivity in epithelial cells.](http://images.novusbio.com/fullsize/p63-TP73L-Antibody-CL3748-Immunohistochemistry-Paraffin-NBP3-05501-img0001.jpg "Immunohistochemistry-Paraffin: p63/TP73L Antibody (CL3748) [NBP3-05501] - Staining of human cervix shows strong nuclear immunoreactivity in epithelial cells.")
![Immunohistochemistry-Paraffin: p63/TP73L Antibody (CL3748) [NBP3-05501] - Staining of human liver shows absence of immunoreactivity (negative control).](http://images.novusbio.com/fullsize/p63-TP73L-Antibody-CL3748-Immunohistochemistry-Paraffin-NBP3-05501-img0002.jpg "Immunohistochemistry-Paraffin: p63/TP73L Antibody (CL3748) [NBP3-05501] - Staining of human liver shows absence of immunoreactivity (negative control).")
![Immunohistochemistry-Paraffin: p63/TP73L Antibody (CL3748) [NBP3-05501] - Staining of human lung cancer (adenocarcinoma) shows absence of immunoreactivity (negative control).](http://images.novusbio.com/fullsize/p63-TP73L-Antibody-CL3748-Immunohistochemistry-Paraffin-NBP3-05501-img0003.jpg "Immunohistochemistry-Paraffin: p63/TP73L Antibody (CL3748) [NBP3-05501] - Staining of human lung cancer (adenocarcinoma) shows absence of immunoreactivity (negative control).")
![Immunohistochemistry-Paraffin: p63/TP73L Antibody (CL3748) [NBP3-05501] - Staining of human placenta shows nuclear positivity in a subset of cells.](http://images.novusbio.com/fullsize/p63-TP73L-Antibody-CL3748-Immunohistochemistry-Paraffin-NBP3-05501-img0004.jpg "Immunohistochemistry-Paraffin: p63/TP73L Antibody (CL3748) [NBP3-05501] - Staining of human placenta shows nuclear positivity in a subset of cells.")
![Immunohistochemistry-Paraffin: p63/TP73L Antibody (CL3748) [NBP3-05501] - Staining of human prostate cancer shows absence of nuclear immunoreactivity in tumor cells, while it is present in the adjacent normal a basal epithelial cells.](http://images.novusbio.com/fullsize/p63-TP73L-Antibody-CL3748-Immunohistochemistry-Paraffin-NBP3-05501-img0005.jpg "Immunohistochemistry-Paraffin: p63/TP73L Antibody (CL3748) [NBP3-05501] - Staining of human prostate cancer shows absence of nuclear immunoreactivity in tumor cells, while it is present in the adjacent normal a basal epithelial cells.")
![Immunocytochemistry CKAP4/p63 Antibody [Unconjugated]](https://images.novusbio.com/images2/CKAP4_AF7355_Immunocytochemistry__Immunofluorescence_17000.jpg)
![Western Blot CKAP4/p63 Antibody [Unconjugated]](https://images.novusbio.com/images2/CKAP4_AF7355_Western_Blot_11997.jpg)
![Immunocytochemistry CKAP4/p63 Antibody [Unconjugated]](https://images.novusbio.com/images2/CKAP4_AF7355_Immunocytochemistry_12002.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![N/A IL-10 [Biotin]](https://images.novusbio.com/images2/DATA_IL10_DY417_ELISA_2014.jpg)
![Bioactivity IFN-gamma [Unconjugated]](https://images.novusbio.com/images2/IFNgamma_285IF_2848.jpg)
![SDS-PAGE IFN-gamma [Unconjugated]](https://images.novusbio.com/images2/IFN-gamma_285-IF_230.jpg)
![SEC-MALS IFN-gamma [Unconjugated]](https://images.novusbio.com/images/285-if_recombinant-human-ifn-gamma-protein-sec-mals-1520239228..jpg)
![SDS-PAGE IL-12 [Unconjugated]](https://images.novusbio.com/images2/IL-12_419-ML_403.jpg)
![Bioactivity IL-12 [Unconjugated]](https://images.novusbio.com/images2/IL-12_419-ML_405.jpg)
![Western Blot Annexin A1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Annexin_A1_AF3770_Western_Blot_5334.jpg)
![Immunohistochemistry Annexin A1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Annexin_A1_AF3770_Immunohistochemistry_10404.jpg)
![Simple Western Annexin A1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Annexin_A1_AF3770_Simple_Western_16649.jpg)
![SDS-Page: Mouse IgG1 Isotype Control (MG1) [NBP1-97005] - Lane 1: , Non-reduced. M: Opal Pre-stained Ladder. Lane 2: , Reduced. Load: 1.0 ug per lane. Predicted/Observed: 120 kDa Non-reduced, 55 and 25 Reduced.](https://images.novusbio.com/images/Mouse-IgG1-Isotype-Control-MG1-SDS-Page-NBP1-97005-img0002.jpg "SDS-Page: Mouse IgG1 Isotype Control (MG1) [NBP1-97005] - Lane 1: , Non-reduced. M: Opal Pre-stained Ladder. Lane 2: , Reduced. Load: 1.0 ug per lane. Predicted/Observed: 120 kDa Non-reduced, 55 and 25 Reduced.")