MMP-17 Antibody - Azide and BSA Free Summary
Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 265-565 of human MMP-17 (NP_057239.4). IMRPYYQGPVGDPLRYGLPYEDKVRVWQLYGVRESVSPTAQPEEPPLLPEPPDNRSSAPPRKDVPHRCSTHFDAVAQIRGEAFFFKGKYFWRLTRDRHLVSLQPAQMHRFWRGLPLHLDSVDAVYERTSDHKIVFFKGDRYWVFKDNNVEEGYPRPVSDFSLPPGGIDAAFSWAHNDRTYFFKDQLYWRYDDHTRHMDPGYPAQSPLWRGVPSTLDDAMRWSDGASYFFRGQEYWKVLDGELEVAPGYPQSTARDWLVCGDSQADGSVAAGVDAAEGPRAPPGQHDQSRSEDGYEVCSCTS |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
MMP17 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA
- Immunohistochemistry 1:50-1:200
- Immunohistochemistry-Paraffin
- Western Blot 1:500-1:2000
|
Theoretical MW |
67 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.3), 50% glycerol |
Preservative |
0.01% Thimerosal |
Purity |
Affinity purified |
Alternate Names for MMP-17 Antibody - Azide and BSA Free
Background
Membrane type (MT) matrix metalloproteinases (MMPs) are recently recognized members of the family of Zn(2+)- and Ca(2+)-dependent MMPs. MMP-17 is, therefore, a competent Zn(2+)-dependent MMP with unique specificity among synthetic substrates and the capability to both degrade gelatin and activate progelatinase A (1). (MMP-17) is expressed mainly in the brain, leukocytes, the colon, the ovary, and the testis. The expression of MMP-17 in leukocytes together with its putative membrane localization suggest that this enzyme could be involved in the activation of membrane-bound precursors of growth factors or inflammatory mediators such as tumor necrosis factor-alpha (2). glycosylphospha-tidylinositol (GPI) anchoring of MT4-MMP on the cell surface indicates a unique biological function and character for this proteinase (3).
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: CyTOF-ready, Flow, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP, WB
Species: Hu
Applications: IHC, IP, WB
Species: Hu
Applications: CyTOF-ready, IHC, ICFlow, WB
Species: Hu, Mu
Applications: IHC, IP, WB
Species: Ca, Hu, Mu, Po, Rt
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA, S-ELISA
Species: Hu
Applications: BA
Species: Bv, Ca, Hu, Mu, Po, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: WB
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, WB
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov
Publications for MMP-17 Antibody (NBP2-94898) (0)
There are no publications for MMP-17 Antibody (NBP2-94898).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MMP-17 Antibody (NBP2-94898) (0)
There are no reviews for MMP-17 Antibody (NBP2-94898).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for MMP-17 Antibody (NBP2-94898) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional MMP-17 Products
Research Areas for MMP-17 Antibody (NBP2-94898)
Find related products by research area.
|
Blogs on MMP-17