![Immunohistochemistry-Paraffin: MBP Antibody (CL2829) [NBP2-46632] - Analysis in human cerebral cortex and liver tissues using NBP2-46632 antibody. Corresponding MBP RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/MBP-Antibody-CL2829-Immunohistochemistry-Paraffin-NBP2-46632-img0011.jpg "Immunohistochemistry-Paraffin: MBP Antibody (CL2829) [NBP2-46632] - Analysis in human cerebral cortex and liver tissues using NBP2-46632 antibody. Corresponding MBP RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ELISA, IHC |
| Clone | CL2829 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence DENPVVHFFKNIVTPRTPPPSQGKGRGLSLSRFSWGAEGQRPGFGYGGRASDYKSAHKGFKGVDAQGTLSKIFKLGGRDSRSGSPM |
| Epitope | RTPPPSQGKG |
| Isotype | IgG1 |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | MBP |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Protein A purified |
![Western Blot Peroxiredoxin 5 Antibody [Unconjugated]](https://images.novusbio.com/images2/Peroxiredoxin_5_AF5724_Western_Blot_5819.jpg)
![Immunocytochemistry Peroxiredoxin 5 Antibody [Unconjugated]](https://images.novusbio.com/images2/Peroxiredoxin_5_AF5724_Immunocytochemistry__Immunofluorescence_19720.jpg)
![Immunocytochemistry Peroxiredoxin 5 Antibody [Unconjugated]](https://images.novusbio.com/images2/Peroxiredoxin_5_AF5724_Immunocytochemistry__Immunofluorescence_19954.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for MBP Antibody (NBP2-46632)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | MBP |
![Western Blot: MBP Antibody (2829) [NBP2-46632] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Mouse Cerebral Cortex tissue](http://images.novusbio.com/fullsize/MBP-Antibody-2829-Western-Blot-NBP2-46632-img0009.jpg "Western Blot: MBP Antibody (2829) [NBP2-46632] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Mouse Cerebral Cortex tissue")
![Immunohistochemistry-Paraffin: MBP Antibody (CL2829) [NBP2-46632] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/MBP-Antibody-CL2829-Immunohistochemistry-Paraffin-NBP2-46632-img0014.jpg "Immunohistochemistry-Paraffin: MBP Antibody (CL2829) [NBP2-46632] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Western Blot: MBP Antibody (2829) [NBP2-46632] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Human Cerebral Cortex tissue](http://images.novusbio.com/fullsize/MBP-Antibody-2829-Western-Blot-NBP2-46632-img0008.jpg "Western Blot: MBP Antibody (2829) [NBP2-46632] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Human Cerebral Cortex tissue")
![Immunohistochemistry: MBP Antibody (2829) [NBP2-46632] - Staining of rat cerebral cortex shows strong immunoreactivity in myelinated fibers.](http://images.novusbio.com/fullsize/MBP-Antibody-2829-Immunohistochemistry-NBP2-46632-img0001.jpg "Immunohistochemistry: MBP Antibody (2829) [NBP2-46632] - Staining of rat cerebral cortex shows strong immunoreactivity in myelinated fibers.")
![Immunohistochemistry: MBP Antibody (2829) [NBP2-46632] - Staining of mouse hippocampal formation shows strong immunoreactivity in myelinated fibers in the dentate gyrus.](http://images.novusbio.com/fullsize/MBP-Antibody-2829-Immunohistochemistry-NBP2-46632-img0002.jpg "Immunohistochemistry: MBP Antibody (2829) [NBP2-46632] - Staining of mouse hippocampal formation shows strong immunoreactivity in myelinated fibers in the dentate gyrus.")
![Immunohistochemistry: MBP Antibody (2829) [NBP2-46632] - Staining of rat basal forebrain shows strong positivity in myelinated fibers.](http://images.novusbio.com/fullsize/MBP-Antibody-2829-Immunohistochemistry-NBP2-46632-img0004.jpg "Immunohistochemistry: MBP Antibody (2829) [NBP2-46632] - Staining of rat basal forebrain shows strong positivity in myelinated fibers.")
![Immunohistochemistry: MBP Antibody (2829) [NBP2-46632] - Staining of mouse cerebellum shows strong immunoreactivity in myelinated fibers.](http://images.novusbio.com/fullsize/MBP-Antibody-2829-Immunohistochemistry-NBP2-46632-img0005.jpg "Immunohistochemistry: MBP Antibody (2829) [NBP2-46632] - Staining of mouse cerebellum shows strong immunoreactivity in myelinated fibers.")
![Immunohistochemistry-Paraffin: MBP Antibody (2829) [NBP2-46632] - Staining of human cerebral cortex shows strong positivity in myelinated fibers.](http://images.novusbio.com/fullsize/MBP-Antibody-2829-Immunohistochemistry-Paraffin-NBP2-46632-img0003.jpg "Immunohistochemistry-Paraffin: MBP Antibody (2829) [NBP2-46632] - Staining of human cerebral cortex shows strong positivity in myelinated fibers.")
![Immunohistochemistry-Paraffin: MBP Antibody (CL2829) [NBP2-46632] - Staining of human cerebellum shows strong positivity in myelinated neural fiebrs.](http://images.novusbio.com/fullsize/MBP-Antibody-CL2829-Immunohistochemistry-Paraffin-NBP2-46632-img0012.jpg "Immunohistochemistry-Paraffin: MBP Antibody (CL2829) [NBP2-46632] - Staining of human cerebellum shows strong positivity in myelinated neural fiebrs.")
![Immunohistochemistry-Paraffin: MBP Antibody (CL2829) [NBP2-46632] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.](http://images.novusbio.com/fullsize/MBP-Antibody-CL2829-Immunohistochemistry-Paraffin-NBP2-46632-img0013.jpg "Immunohistochemistry-Paraffin: MBP Antibody (CL2829) [NBP2-46632] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.")
![Immunohistochemistry PTHLH/PTHrP Antibody (677939) [Unconjugated]](https://images.novusbio.com/images2/PTHLH_MAB6734_Immunohistochemistry_10816.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Bioactivity IL-2 [Unconjugated]](https://images.novusbio.com/images/202-il_recombinant-human-il-2-protein-bioactivity-174202314946.jpg)
![Bioactivity GM-CSF [Unconjugated]](https://images.novusbio.com/images/protein/7954-gmcf_recombinant-human-gm-csf-cho-expressed-protein-cf-bioactivity-272020121514.jpg)
![Bioactivity IFN-gamma [Unconjugated]](https://images.novusbio.com/images2/IFNgamma_285IF_2848.jpg)
![SDS-PAGE IFN-gamma [Unconjugated]](https://images.novusbio.com/images2/IFN-gamma_285-IF_230.jpg)
![SEC-MALS IFN-gamma [Unconjugated]](https://images.novusbio.com/images/285-if_recombinant-human-ifn-gamma-protein-sec-mals-1520239228..jpg)
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![Bioactivity IL-4 [Unconjugated]](https://images.novusbio.com/images/protein/6507-ilcf_recombinant-human-il-4-cho-expressed-protein-cf-bioactivity-272020133214.jpg)
![N/A IL-10 [Biotin]](https://images.novusbio.com/images2/DATA_IL10_DY417_ELISA_2014.jpg)
![SDS-Page: Mouse IgG1 Isotype Control (MG1) [NBP1-97005] - Lane 1: , Non-reduced. M: Opal Pre-stained Ladder. Lane 2: , Reduced. Load: 1.0 ug per lane. Predicted/Observed: 120 kDa Non-reduced, 55 and 25 Reduced.](https://images.novusbio.com/images/Mouse-IgG1-Isotype-Control-MG1-SDS-Page-NBP1-97005-img0002.jpg "SDS-Page: Mouse IgG1 Isotype Control (MG1) [NBP1-97005] - Lane 1: , Non-reduced. M: Opal Pre-stained Ladder. Lane 2: , Reduced. Load: 1.0 ug per lane. Predicted/Observed: 120 kDa Non-reduced, 55 and 25 Reduced.")