MBP Antibody (7D2) [Janelia Fluor® 646] Summary
Immunogen |
Purified myelin basic protein isolated from bovine brain, epitope maps to the peptide AEGQRPGFGYGGRASDYKSAHKGFKGVDAQGTLSKIFKLG, amino acids 145-184 of the human 21.5kDa sequence. |
Marker |
Oligodendrocyte Marker, Myelin Marker |
Specificity |
The MBP Antibody (7D2) antibody binds only the 21.5kDa and 18.5kDa rat MBP isotypes, but all four isotypes of human and bovine MBP. |
Isotype |
IgG1 |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
MBP |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/ Immunofluorescence
- Immunohistochemistry
- Western Blot
|
Application Notes |
Optimal dilution of this antibody should be experimentally determined. |
Packaging, Storage & Formulations
Storage |
Store at 4C in the dark. |
Buffer |
50mM Sodium Borate |
Preservative |
0.05% Sodium Azide |
Purity |
Affinity purified |
Notes
Sold under license from the Howard Hughes Medical Institute, Janelia Research Campus.
Alternate Names for MBP Antibody (7D2) [Janelia Fluor® 646]
Background
Myelin Basic Protein (MBP) functions in the nervous system in myelination and is expressed in oligodendrocytes following differentiation. There are numerous isoforms generated by differential splicing events and post-translational modifications that have specialized functions. These functions include participation in signaling pathways prior to myelination, myelination or the re-myelination process following neural injury.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu, Rt
Applications: WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Rt
Applications: BA
Species: Hu
Applications: IHC
Species: Hu, Mu, Rt
Applications: ICC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu
Applications: BA
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: ELISA
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Publications for MBP Antibody (NBP1-05204JF646) (0)
There are no publications for MBP Antibody (NBP1-05204JF646).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MBP Antibody (NBP1-05204JF646) (0)
There are no reviews for MBP Antibody (NBP1-05204JF646).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for MBP Antibody (NBP1-05204JF646) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional MBP Products
Research Areas for MBP Antibody (NBP1-05204JF646)
Find related products by research area.
|
Blogs on MBP