![Immunohistochemistry-Paraffin: MARCO Antibody [NBP2-39004] - Staining in human lung and pancreas tissues . Corresponding MARCO RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/MARCO-Antibody-Immunohistochemistry-Paraffin-NBP2-39004-img0013.jpg "Immunohistochemistry-Paraffin: MARCO Antibody [NBP2-39004] - Staining in human lung and pancreas tissues . Corresponding MARCO RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LNLQARLRVLEMYFLNDTLAAEDSPSFSLLQSAHPGEHLAQGASRLQVLQAQLTWVRV |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | MARCO |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP2-39004 | Applications | Species |
|---|---|---|
| Chen Y, Hao X, Li M et al. UGRP1-modulated MARCO+ alveolar macrophages contribute to age-related lung fibrosis Immunity & ageing : I & A 2023-03-18 [PMID: 36934284] (IHC-P, Human) | IHC-P | Human |
| Images | Ratings | Applications | Species | Date | Details | ||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Verified Customer |
ICC | Human | 05/17/2016 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Research Areas for MARCO Antibody (NBP2-39004)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: MARCO Antibody [NBP2-39004] - Staining of human cell line HeLa shows localization to the Golgi apparatus. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/MARCO-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-39004-img0006.jpg "Immunocytochemistry/Immunofluorescence: MARCO Antibody [NBP2-39004] - Staining of human cell line HeLa shows localization to the Golgi apparatus. Antibody staining is shown in green.")
![Immunohistochemistry: MARCO Antibody [NBP2-39004] - Staining in normal human liver. Image from a verified customer review.](http://images.novusbio.com/fullsize/MARCO-Antibody-Immunohistochemistry-NBP2-39004-img0014.jpg "Immunohistochemistry: MARCO Antibody [NBP2-39004] - Staining in normal human liver. Image from a verified customer review.")
![Immunohistochemistry-Paraffin: MARCO Antibody [NBP2-39004] - Staining of human liver shows strong positivity in Kupffer cells.](http://images.novusbio.com/fullsize/MARCO-Antibody-Immunohistochemistry-Paraffin-NBP2-39004-img0009.jpg "Immunohistochemistry-Paraffin: MARCO Antibody [NBP2-39004] - Staining of human liver shows strong positivity in Kupffer cells.")
![Immunohistochemistry-Paraffin: MARCO Antibody [NBP2-39004] - Staining of human lung shows strong positivity in macrophages.](http://images.novusbio.com/fullsize/MARCO-Antibody-Immunohistochemistry-Paraffin-NBP2-39004-img0010.jpg "Immunohistochemistry-Paraffin: MARCO Antibody [NBP2-39004] - Staining of human lung shows strong positivity in macrophages.")
![Immunohistochemistry-Paraffin: MARCO Antibody [NBP2-39004] - Staining of human lymph node shows moderate membranous positivity.](http://images.novusbio.com/fullsize/MARCO-Antibody-Immunohistochemistry-Paraffin-NBP2-39004-img0011.jpg "Immunohistochemistry-Paraffin: MARCO Antibody [NBP2-39004] - Staining of human lymph node shows moderate membranous positivity.")
![Immunohistochemistry-Paraffin: MARCO Antibody [NBP2-39004] - Staining of human pancreas shows no positivity as expected.](http://images.novusbio.com/fullsize/MARCO-Antibody-Immunohistochemistry-Paraffin-NBP2-39004-img0012.jpg "Immunohistochemistry-Paraffin: MARCO Antibody [NBP2-39004] - Staining of human pancreas shows no positivity as expected.")
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Bioactivity CTLA-4 [Unconjugated]](https://images.novusbio.com/images2/CTLA4_7268CT_2293.jpg)
![N/A IL-10 [Biotin]](https://images.novusbio.com/images2/DATA_IL10_DY417_ELISA_2014.jpg)
![Bioactivity IL-4 [Unconjugated]](https://images.novusbio.com/images/protein/6507-ilcf_recombinant-human-il-4-cho-expressed-protein-cf-bioactivity-272020133214.jpg)
![N/A CD14 [HRP]](https://images.novusbio.com/images2/CD14_DC140_ELISA_42.jpg)
![N/A CD14 [HRP]](https://images.novusbio.com/images2/DATA_CD14_DC140_ELISA_597.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
