Reactivity | Hu, RtSpecies Glossary |
Applications | IHC |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Immunogen | Laminin Antibody was made to a recombinant protein corresponding to amino acids: TVSYDIPVETVDSNLMSHADVIIKGNGLTLSTQAEGLSLQPYEEYLNVVRLVPENFQDFHSKRQIDRDQLMTVLANVTHLLIRANYNSAKMALYRLESVS |
Predicted Species | Rat (91%). Backed by our 100% Guarantee. |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | LAMA1 |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Theoretical MW | 337 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.2) and 40% Glycerol |
Preservative | 0.02% Sodium Azide |
Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Laminin Antibody (NBP2-34181)Find related products by research area.
|
Alpha-smooth muscle actin and the modulation of endothelial and epithelial cell biology Actin is essential for a wide range of cell functions, ranging from cell division and chromatin remodeling to vesicle trafficking and maintenance of cellular structure. In fact, mislocalization of actin to cell junctions during development leads t... Read full blog post. |
Epithelial-Mesenchymal Transition (EMT) Markers Epithelial-Mesenchymal Transition (EMT) is the trans-differentiation of stationary epithelial cells into motile mesenchymal cells. During EMT, epithelial cells lose their junctions and apical-basal polarity, reorganize their cytoskeleton, undergo a... Read full blog post. |
Could Laminin be Used to Treat Duchenne Muscular Dystrophy? Duchenne muscular dystrophy (DMD) is a severe muscle wasting condition, causing disability and early death. There is currently no cure or adequate treatment for DMD, but pioneering research indicates that injection of a laminin protein may prevent (or... Read full blog post. |
Using the Laminin Antibody in Angiogenesis Research Laminin is one of a large number of proteins expressed on the basal laminar of the ECM (extracellular matrix). The laminin antibody database covers several proteins, which interact with integrins and other receptor proteins to support cellular differe... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.